SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010932 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010932
Domain Number 1 Region: 30-241
Classification Level Classification E-value
Superfamily ALDH-like 6.24e-63
Family ALDH-like 0.00000000389
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010932   Gene: ENSMMUG00000008336   Transcript: ENSMMUT00000011659
Sequence length 241
Comment pep:known chromosome:MMUL_1:11:112707107:112746261:1 gene:ENSMMUG00000008336 transcript:ENSMMUT00000011659 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRAAARFGPRLGLRFLSAAATQAVPAPNQQPEVFCNKIFINNEWHNAVSRKTFPTVNPS
TGEVICQVAEGDKEDVDKAVKAARAAFQLGSPWRRMDASHRGRLLNRLADLIERDRTYLA
ALETLDNGKPYVTSYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSYTRHEPVGDVD
KVAFTGSTETGRLIQVAAGSSNLKRVTLELGGKSPNIIMSDADMDWAVEQAHFALFFNQG
Q
Download sequence
Identical sequences ENSMMUP00000010932

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]