SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000010981 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000010981
Domain Number 1 Region: 47-95
Classification Level Classification E-value
Superfamily LEM domain 0.0000000000118
Family LEM domain 0.00015
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000010981
Domain Number - Region: 83-120
Classification Level Classification E-value
Superfamily Outer membrane efflux proteins (OEP) 0.00746
Family Outer membrane efflux proteins (OEP) 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000010981   Gene: ENSMMUG00000008377   Transcript: ENSMMUT00000011710
Sequence length 286
Comment pep:novel chromosome:MMUL_1:20:72772872:72774061:1 gene:ENSMMUG00000008377 transcript:ENSMMUT00000011710 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
PPLAASANSNGPQEFSSYESASPQALDSGPAADRKATKKTDKPRQDKDNLDVTELINEDL
LDQLVKYGVNPGPIVGTTRKLCEKNLLKAREQRTESRSSPLPTISSSAENTRQNGSNDSD
RYSDNEEDPKIELKLEKREPLKGRAKTPVTLKQRRVEHNKRAEVGEKTQERRVERDIPKE
TFPCEAATPTRISASCRRPIKGAPGRPLELSDLRMEESFSSKYVCKYVPSTDVKEKIRKK
GHSIPVWIKILLFVVVAVFFLVYQAMETNHINPFSNFLPDGSRKPN
Download sequence
Identical sequences ENSMMUP00000010981 ENSMMUP00000010981 9544.ENSMMUP00000010981

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]