SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011009 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011009
Domain Number 1 Region: 44-175
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 5.37e-36
Family Methylmalonyl-CoA epimerase 0.0026
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011009   Gene: ENSMMUG00000008396   Transcript: ENSMMUT00000011740
Sequence length 176
Comment pep:known chromosome:MMUL_1:13:71364275:71380878:-1 gene:ENSMMUG00000008396 transcript:ENSMMUT00000011740 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARALRAAAGNAIGLFSRLQAPIPTLRASSTSQPLDQVAGSLWNLGRLNHVAIAVPDLEK
AAAFYKNILGAQVSEAVPLPEHGVSVVFVNLGNTKMELLHPLGRDSPIAGFLQKNKAGGM
HHICIEVDNINAAVMDLKTKKIRSLSEEVKIGAHGKPVIFLHPKDCGGVLVELEQA
Download sequence
Identical sequences A0A2K5WLL5
ENSMMUP00000011009 ENSMMUP00000011009 9544.ENSMMUP00000011009 XP_001102303.1.72884 XP_005575690.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]