SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011026 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011026
Domain Number 1 Region: 1119-1274,1313-1392
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.98e-40
Family Voltage-gated potassium channels 0.024
Further Details:      
 
Domain Number 2 Region: 1441-1638,1666-1691
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 4.24e-39
Family Voltage-gated potassium channels 0.021
Further Details:      
 
Domain Number 3 Region: 670-817,851-898
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.65e-31
Family Voltage-gated potassium channels 0.019
Further Details:      
 
Domain Number 4 Region: 40-185,274-343
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 2.28e-30
Family Voltage-gated potassium channels 0.017
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000011026
Domain Number - Region: 1700-1745
Classification Level Classification E-value
Superfamily EF-hand 0.0112
Family Calmodulin-like 0.065
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011026   Gene: ENSMMUG00000008407   Transcript: ENSMMUT00000011757
Sequence length 1909
Comment pep:known_by_projection chromosome:MMUL_1:12:29631557:29707897:-1 gene:ENSMMUG00000008407 transcript:ENSMMUT00000011757 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTFIVLNKGKAIFRFSATSALYILTPFNPLRKIAIKILVHSFFNMLIMCTILTNCVFMTM
SNPPDWTKNVEYTFTGIYTFESLIKIIARGFCLEDFTFLRDPWNWLDFTVITFAYVTEFV
DLGNVSALRTFRVLRALKTISVIPGLKTIVGALIQSVKKLSDVMILTVFCLSVFALIGLQ
LFMGNLRNKCIQWPPTNASLEEHSVEKNITVNYNGTLINETVFEFDWKSYIQDSRYHYFL
EGFLDALLCGNSSDAGQCPEGYVCVKAGRNPNYGYTSFDTFSWAFLSLFRLMTQDFWENL
YQLTLRAAGKTYMIFFVLVIFLGSFYLINLILAVVAMAYEEQNQATLEEAEQKEAEFQQM
IEQLKKQQEAAQQAATATASEHSREPSAAGRLSDSSSEASKLSSKSAKERRNRRKKRKQK
EQSGGEEKDEDEFHKSESEDSIRRKGFRFSIEGNRLTYEKRYSSPHQSLLSIRGSLFSPR
RNSRTSLFSFRGRAKDVGSENDFADDEHSTFEDNESRRDSLFVPRRHGERRNSNLSQTSR
SSRMLAVFPANGKMHSTVDCNGVVSLVGGPSVPTSPVGQLLPEGTTTETEMRKRRSSSFH
VSMDFLEDPSQRQRAMSIASILTNTVEELEESRQKCPPCWYKFSNIFLIWDCSPYWLKVK
HVVNLVVMDPFVDLAITICIVLNTLFMAMEHYPMTDHFNNVLTVGNLVFTGIFTAEMFLK
IIAMDPYYYFQEGWNIFDGFIVTLSLVELGLANVEGLSVLRSFRLLRVFKLAKSWPTLNM
LIKIIGNSVGALGNLTLVLAIIVFIFAVVGMQLFGKSYKDCVCKIASDCQLPRWHMNDFF
HSFLIVFRVLCGEWIETMWDCMEVAGQAMCLTVFMMVMVIGNLVVLNLFLALLLSSFSAD
NLAATDDDNEMNNLQIAVDRMHKGVAYVKRKIYEFIQQSFIRKQKILDEIKPLDDLNNKK
DSCMSNHTTEIGKDLDYLKDVNGTTSGIGTGSSVEKYIIDESDYMSFINNPSLTVTVPIA
VGESDFENLNTEDFSSESDLEESKEKLNESSSSSEGSTVDIGAPAEEQPVVEPEETLEPE
ACFTEGCVQRFKCCQINVEEGRGKQWWNLRRTCFRIVEHNWFETFIVFMILLSSGALAFE
DIYIDQRKTIKTMLEYADKVFTYIFILEMLLKWVAYGYQTYFTNAWCWLDFLIVDVSLVS
LTANALGYSELGAIKSLRTLRALRPLRALSRFEGMRVVVNALLGAIPSIMNVLLVCLIFW
LIFSIMGVNLFAGKFYHCINTTTGDRFDIEDVNNHTDCLKLIERNETARWKNVKVNFDNV
GFGYLSLLQVATFKGWMDIMYAAVDSRNVELQPKYEESLYMYLYFVIFIIFGSFFTLNLF
IGVIIDNFNQQKKKISQDIFMTEEQKKYYNAMKKLGSKKPQKPIPRPGNKFQGMVFDFVT
RQVFDISIMILICLNMVTMMVETDDQSEYVTTILSRINLVFIVLFTGECVLKLISLRHYY
FTIGWNIFDFVVVILSIVGMFLAELIEKYFVSPTLFRVIRLARIGRILRLIKGAKGIRTL
LFALMMSLPALFNIGLLLFLVMFIYAIFGMSNFAYVKREVGIDDMFNFETFGNSMICLFQ
ITTSAGWDGLLAPILNSKPPDCDPNKVNPGSSVKGDCGNPSVGIFFFVSYIIISFLVVVN
MYIAVILENFSVATEESAEPLSEDDFEMFYEVWEKFDPDATQFMEFEKLSQFAAALEPPL
NLPQPNKLQLIAMDLPMVSGDRIHCLDILFAFTKRVLGESGEMDALRIQMEERFMASNPS
KVSYQPITTTLKRKQEEVSAVIIQRAYRRHLLKRTVKQASFTYNKNKIKGGANLIKEDMI
IDRINENSITEKTDLTMSTAACPPSYDRVTKPIVEKHEQEGKDEKAKGK
Download sequence
Identical sequences ENSMMUP00000011026 9544.ENSMMUP00000011026 ENSMMUP00000011026

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]