SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011071 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011071
Domain Number 1 Region: 9-349
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 2.7e-100
Family Protein kinases, catalytic subunit 0.00000000000781
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011071   Gene: ENSMMUG00000008444   Transcript: ENSMMUT00000011805
Sequence length 360
Comment pep:known chromosome:MMUL_1:4:35782275:35863583:1 gene:ENSMMUG00000008444 transcript:ENSMMUT00000011805 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSQERPTFYRQELNKTIWEVPERYQNLSPVGSGAYGSVCAAFDTKTGLRVAVKKLSRPFQ
SIIHAKRTYRELRLLKHMKHENVIGLLDVFTPARSLEEFNDVYLVTHLMGADLNNIVKCQ
KLTDDHVQFLIYQILRGLKYIHSADIIHRDLKPSNLAVNEDCELKILDFGLARHTDDEMT
GYVATRWYRAPEIMLNWMHYNQTVDIWSVGCIMAELLTGRTLFPGTDHINQLQQIMRLTG
TPPAYLINRMPSHEARNYIQSLTQMPKMNFANVFIGANPLAVDLLEKMLVLDSDKRITAA
QALAHAYFAQYHDPDDEPVADPYDQSFESRDLLIDEWKSLTYDEVVSFVPPPLDQEEMES
Download sequence
Identical sequences A0A1S3G9Z2 A0A2I3LNN6 A0A2K5KEU2 A0A2K5NM43 A0A2K5WJV8 A0A2K6EB32 A0A2K6LWL1 A0A2K6QA67 F6V370
ENSMMUP00000011071 XP_005553249.1.63531 XP_005627084.1.84170 XP_007970998.1.81039 XP_010387976.1.97406 XP_011727539.1.29376 XP_011800750.1.43180 XP_011930441.1.92194 XP_012885069.1.60039 XP_014991720.1.72884 XP_017725573.1.44346 XP_019594309.1.88060 9544.ENSMMUP00000011071 9615.ENSCAFP00000031957 ENSMMUP00000011071

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]