SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011251 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011251
Domain Number 1 Region: 161-280
Classification Level Classification E-value
Superfamily C-type lectin-like 1.13e-38
Family Link domain 0.0018
Further Details:      
 
Domain Number 2 Region: 283-365
Classification Level Classification E-value
Superfamily C-type lectin-like 4.88e-24
Family Link domain 0.0039
Further Details:      
 
Domain Number 3 Region: 47-160
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000000245
Family V set domains (antibody variable domain-like) 0.04
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011251   Gene: ENSMMUG00000008578   Transcript: ENSMMUT00000011994
Sequence length 401
Comment pep:known chromosome:MMUL_1:19:18909596:18913301:-1 gene:ENSMMUG00000008578 transcript:ENSMMUT00000011994 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCARAALGPGALWAAAWGVLLLTAPAGAQRGRKKVVHVLEGESGSVVVQTAPGQVVSHRG
GTIVLPCRYHYEAAAHGHDGVRLKWTKVVDPLAFTDVFVALGPQHRAFGSYRGRAELQGD
GPGDASLVLRNVTLQDYGRYECEVTNELEDDAGMVKLDLEGVVFPYHPRGGRYKLTFAEA
QRACAEQDGILASAEQLHAAWRDGLDWCNAGWLRDGSVQYPVNRPREPCGGLGGTGSTGD
GGDANGGVRNYGYRHNAEERYDAFCFTSNLPGRVFFLKPLRPVPFSGAARACAARGAAVA
KVGQLFAAWKLQLLDRCTAGWLADGSARYPIVNPRMRCGGRRPGVRSLGFPDATRRLFGV
YCYRAPGAPDPAPGGWGWGWAGGGGWAGGARDPAAWTPLRV
Download sequence
Identical sequences ENSMMUP00000011251 ENSMMUP00000011251 9544.ENSMMUP00000011251

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]