SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011502 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011502
Domain Number 1 Region: 875-985
Classification Level Classification E-value
Superfamily cAMP-binding domain-like 0.00000000000047
Family cAMP-binding domain 0.043
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000011502
Domain Number - Region: 621-722
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00502
Family Voltage-gated potassium channels 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011502   Gene: ENSMMUG00000008779   Transcript: ENSMMUT00000012263
Sequence length 1124
Comment pep:known_by_projection chromosome:MMUL_1:1:203147819:203241852:-1 gene:ENSMMUG00000008779 transcript:ENSMMUT00000012263 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSYIWAQNKSNRPDLLCGQPADYLIEEEHFTTLVCFIVVLGGLLKMCLKNSEVIVLTIL
SLSGFVIGQMAYSSVEVHQIVYPLLKTSSFSLYSYFSPLIIFMVALDVDFYILKNMFWQV
LLTGLISFSTASIILGYVVIKFNKASWDLQSCLLFSITLGITDPLRSVNSLKTIGISKMY
IDLIRGESLIICSITSVFLGNFRGSGIRFSVFRDVHVGIGLILDILGSIIFGYWCAKIIR
CILADVFSNMLTNIILCFSMVYMTFYIVELLGMSGTLALVAVGLNLDSLTFKPKIEFVIT
KFLRIFSCVYEHLIYTFFGIVIGCGELDHYELYTITFIVILFTTVNLVRLLTILLVSPIL
MHSSYEYNWRWGVVITWSGIKGVFNLLLAPDIYNLAEQKVDVPQMFILYVQVVSLLTMGI
NSYVMTQSARKLDLCVLSLPRQMALQNATQHIQEIVQNTISLSKGEKILTNVNWTLVEDK
TRIEYIPSSHVSHKDMKMESTTDEALIEEARLHVATIQMSSFEKQRNNGILEIEAARILI
GAAKCYYSTQGKFMSIYDVSTYMRTRSWLMKFKTVLTFLDYRKEKIHFIPPESNAFLTFI
FHIVFSEEFEYTGQIINLIYIYPMMTHLWPMARDLHVSALISINYYFMFLYVLESTLKII
ILKRKYFRQYWNTLEFFILVVGIIDIFCVYFVKLRRHNLALIQLTVIMGYLRIIRFLPLF
KIIVPILVNIADVQIKKRLSLMYSITKGYIKSQEDAKLLIKQISVHESIYQKLYEILETN
KQDAVKELGLIEHEGRDVVIALKTKQAIRNVIAKALKNLTFLCSRGIIDKHDSTEINKVL
LKKLKALNNFPKAIPPPTPDKYLHNIIWLEGKDVLIDFFKERAKLACFDYGDIICKAGEM
PQGIYLIISGMAILHSLSPTFGIESSQRPDRKSSDMFTEFCTAGDIIGELNCLLKCEIEY
TVICETSLQACFISLEDLYEGFDAFWPSLEYKIWLKLALSTAYQYFEPSLIDEDLKFQKC
VMFNQAYVETLSSYNEMNIDNMTMKFVILVYGSVIDTKTEEPYFAPCIIPTTCEQVQGTS
DLSKLLIVQASELTQRNSNTNVMALSTLVFKQQGENMTGRQEMR
Download sequence
Identical sequences 9544.ENSMMUP00000011502 ENSMMUP00000011502 ENSMMUP00000011502

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]