SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011525 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011525
Domain Number 1 Region: 33-129
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000832
Family V set domains (antibody variable domain-like) 0.096
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011525   Gene: ENSMMUG00000008791   Transcript: ENSMMUT00000012286
Sequence length 305
Comment pep:known chromosome:MMUL_1:2:28139753:28184692:-1 gene:ENSMMUG00000008791 transcript:ENSMMUT00000012286 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MWPLVAALLLGSACCGSAQLLFNKTKSVEFTFCNDTVVIPCFVTNMEAQNTTEVYVKWKF
KGRDIYTFDGALNKSTAPANFSSAKIEVSQLLKGDASLKMDKSDAVSHTGNYTCEVTELT
REGETIIELKYRVVSWFSPNENILIVIFPIFAILLFWGQFGIKTLKYRSGGMDEKTIALL
VAGLMITVIVIVGAILFVPGEYSLKNATGLGLIVTSTGILILLHYYVFSTAIGLTSFVIA
ILVIQVIAYILAVVGLSLCIAACIPMHGPLLISGLSILALAQLLGLVYMKFVASNQKTIQ
PPRNN
Download sequence
Identical sequences A0A2K5LTM5 A0A2K5X4H8 A0A2K6DDN0 F7F5Z8
XP_005548291.1.63531 XP_011732393.1.29376 XP_011947876.1.92194 XP_014985227.1.72884 ENSMMUP00000011525

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]