SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011644 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011644
Domain Number 1 Region: 17-83
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 4.58e-24
Family Ribosomal L11/L12e N-terminal domain 0.00038
Further Details:      
 
Domain Number 2 Region: 80-155
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 2.88e-17
Family Ribosomal protein L11, C-terminal domain 0.00072
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011644   Gene: ENSMMUG00000008876   Transcript: ENSMMUT00000012415
Sequence length 192
Comment pep:known chromosome:MMUL_1:14:8013397:8017206:1 gene:ENSMMUG00000008876 transcript:ENSMMUT00000012415 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSKLGRTTRGLRKPEVGGVIRTIVRAGLAMPGPPLGPVLGQRGVSINQFCKEFNERTKDI
KEGIPLPTKIFVKPDRTFEIKIGQPTVSYFLKAAAGIEKGARQTGKEVAGLVTLKHVYEI
ACIKAQDEAFALQDVPLSSVVRSIIGSARSLGIRVVKDLSSEELAAFQKERAIFLAAQKE
ADLAAQEEAAKK
Download sequence
Identical sequences A0A0D9R790 F7DTM2 G7PP94
NP_001248056.1.72884 XP_005577214.1.63531 XP_007972970.1.81039 ENSMMUP00000011644 9544.ENSMMUP00000011644 ENSMMUP00000011644

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]