SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011666 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011666
Domain Number 1 Region: 58-313
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.28e-63
Family Eukaryotic proteases 0.000000124
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000011666
Domain Number - Region: 20-66
Classification Level Classification E-value
Superfamily Complement control module/SCR domain 0.0549
Family Complement control module/SCR domain 0.0016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011666   Gene: ENSMMUG00000008897   Transcript: ENSMMUT00000012442
Sequence length 317
Comment pep:known chromosome:MMUL_1:11:7402083:7414954:-1 gene:ENSMMUG00000008897 transcript:ENSMMUT00000012442 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ISEASRGSEAISAPGDNPAKVQNHCQEPYYQAAVAGTLTGTNPGTWKDRQDGEEVLQCMP
VCGRPVTPIAQNQTTLRSSRAKLGNFPWQAFTSIHGRGGGALLGDRWILTAAHTIYPKDS
VSLRKNRSVNVFLGHTAIDEMLKLGNHPVRRVIVHPDYRQNESHNFSGDIALLELQHSIP
LGPNILPVCLPDNETLYRSGLLGYVSGFGVEMGWLTTELKYSRLPVAPREACEAWLQKRQ
RPEVFSDDMFCVGDETQRHSVCQGDSGSVYVVWDDRAHHWVATGIVSWGIGCGEGYDFYT
KVLSYVDWIKGVMNGKN
Download sequence
Identical sequences 9544.ENSMMUP00000011666 ENSMMUP00000011666 ENSMMUP00000011666

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]