SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011809 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011809
Domain Number 1 Region: 6-96
Classification Level Classification E-value
Superfamily DNA-binding domain 4.9e-28
Family Methyl-CpG-binding domain, MBD 0.00084
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000011809
Domain Number - Region: 192-283
Classification Level Classification E-value
Superfamily ARM repeat 0.0719
Family Clathrin adaptor core protein 0.043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011809   Gene: ENSMMUG00000009014   Transcript: ENSMMUT00000012595
Sequence length 291
Comment pep:known chromosome:MMUL_1:19:1351653:1366655:-1 gene:ENSMMUG00000009014 transcript:ENSMMUT00000012595 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERKRWECPALPQGWEREEVPRRSGLSAGHRDVFYYSPSGKKFRSKPQLARYLGGSMDLS
TFDFRTGKMLMSKMNKSRQRVRYDSSNQVKGKPDLNTALPVRQTASIFKQPVTKITNHPS
NKVKSDPQKAVDQPRQLFWEKKLSGLNAFDIAEELVKTMDLPKGLQGVGPGCTDETLLSA
IASALHTSTMPITGQLSAAVEKNPGVWLNTTQPLCKAFMVTDEDIRKQEELVQQVRKRLE
EALMADMLAHVEELARDGEAPLDKACTEDDDEEDEEDEEEEPDPDPEMEHV
Download sequence
Identical sequences A0A0A0MX39 A0A2K5P0C0 A0A2K5VLE4 I2CUX7
ENSMMUP00000011809 NP_001180972.1.72884 XP_005587473.1.63531 XP_011746986.1.29376 XP_011928304.1.92194 9544.ENSMMUP00000011809 ENSMMUP00000011809

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]