SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011874 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011874
Domain Number 1 Region: 793-886
Classification Level Classification E-value
Superfamily Immunoglobulin 1.96e-23
Family I set domains 0.011
Further Details:      
 
Domain Number 2 Region: 1202-1293
Classification Level Classification E-value
Superfamily Immunoglobulin 1.59e-22
Family I set domains 0.012
Further Details:      
 
Domain Number 3 Region: 1091-1185
Classification Level Classification E-value
Superfamily Immunoglobulin 1.93e-22
Family I set domains 0.024
Further Details:      
 
Domain Number 4 Region: 898-988
Classification Level Classification E-value
Superfamily Immunoglobulin 2.8e-22
Family I set domains 0.0024
Further Details:      
 
Domain Number 5 Region: 606-699
Classification Level Classification E-value
Superfamily Immunoglobulin 1.09e-19
Family I set domains 0.012
Further Details:      
 
Domain Number 6 Region: 439-523
Classification Level Classification E-value
Superfamily Immunoglobulin 1.25e-17
Family I set domains 0.0069
Further Details:      
 
Domain Number 7 Region: 353-436
Classification Level Classification E-value
Superfamily Immunoglobulin 1.53e-16
Family I set domains 0.0066
Further Details:      
 
Domain Number 8 Region: 3-88
Classification Level Classification E-value
Superfamily Immunoglobulin 3.34e-16
Family I set domains 0.013
Further Details:      
 
Domain Number 9 Region: 527-612
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000000161
Family I set domains 0.014
Further Details:      
 
Domain Number 10 Region: 91-175
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000445
Family I set domains 0.012
Further Details:      
 
Domain Number 11 Region: 182-261
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000000991
Family I set domains 0.01
Further Details:      
 
Domain Number 12 Region: 261-344
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000000003
Family I set domains 0.025
Further Details:      
 
Domain Number 13 Region: 695-790
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000113
Family I set domains 0.0086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011874   Gene: ENSMMUG00000009038   Transcript: ENSMMUT00000012661
Sequence length 1294
Comment pep:known chromosome:MMUL_1:12:42379611:42415230:-1 gene:ENSMMUG00000009038 transcript:ENSMMUT00000012661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VDVITPLKDVNVIEGTKAVLECKVSVPDVTSVKWYLNDEQIKPDDRVHAIVKGTKQRLVI
NRTHASDEGPYKLIVGRVETNCNLSVEKIKIIRGLRDLTCTETQNVVFEVELSHSGIDVL
WNFKDKEIKPSSKYKIEAHGKIYKLTVLNMMKDDEGKYTFYAGENMTSGKLTVAGGAISK
PLTDQTVAESQEAVFECEVANPDSKGEWLRDGKHLPLTNNIRSESDGHKRRLIIAATKLD
DIGEYTYKVATSKTSAKLKVEAVKIKKTLKNLTVTETQDAVFTVELTHPNVKGVQWIKNG
VVLESNEKYAISVKGTVYSLRIKNCAIVDESVYGFRLGRLGASARLHVETVKIIKKPKDV
TALENATVAFEVSVSHDTVPVKWFHKNVEIKPSDKHRLVSERKVHKLMLQNISPSDAGEY
TAVVGQLECKAKLFVETLHITKTMKNIEVPETKTASFECEVSHFNVPSMWLKNGVEIEMS
EKFKIVVQGKLHQLIIMNTSTEDSAEYTFVCGNDQVSATLTVTPIMITSMLKDINAEEKD
TITFEVTVNYEGISYKWLKNGVEIKSTDKCQMRTKKLTHSLNIRNVHFGDAADYTFVAGK
ATSTATLYVEARHIEFRKHIKDIKVLEKKRAMFECEVSEPDITVQWMKDDQELQITDRIK
IQKEKYVHRLLIPSTRMSDAGKYTVVAGGNVSTANLFVEGRDVRIRSIKKEVQVIEKQRA
VVEFEVNEDDVDAHWYKDGIEINFQVQERHKYVVERRIHRMFISETRQSDAGEYTFVAGR
NRSSVTLYVNAPEPPQVLQELQPVTVQSGKPARFCAVISGRPQPKISWYKEEQLLSTGFK
CKFLHDGQEYTLLLIEAFPEDAAVYTCEAKNDYGVATTSASLSVEVPEIVSPDQEMPVYP
PAIITPLQDTVTSEGQPARFQCRVSGTDLKVSWYSKDKKIKPSRFFRMTQFEDTYQLEIA
EAYPEDEGTYTFVASNAVGQVSSTANLSLEVQALDRQSSGKDVRESTKSQAVADSSFTKE
DSKISQKDIKSYQGSSYEYEVQVFESVSQSSIHTAASIQDIQLRHTASLSEIAESTELSK
ECAEESMGEAPKILLHLQDITVKCGDTAQFLCVLKDDSFIDVTWTHEGAKIEESERLKQS
QNGNIQFLTICKVQLADQGLYSCIVHNDCGERTTSAVLSVEGAPESILHERIEQEIEMEM
KAAPVIRRRIEPLEVALGHLAKFTCEIQSAPNVRFQWFKAGREIYESDKCSIRSSKYVSS
LEILRTQVVDCGEYTCKASNEYGSVSCTATLTVT
Download sequence
Identical sequences ENSMMUP00000011874

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]