SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011881 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011881
Domain Number 1 Region: 30-227
Classification Level Classification E-value
Superfamily Concanavalin A-like lectins/glucanases 6.34e-37
Family Laminin G-like module 0.0019
Further Details:      
 
Domain Number 2 Region: 267-333
Classification Level Classification E-value
Superfamily FnI-like domain 0.000000000023
Family VWC domain 0.013
Further Details:      
 
Domain Number 3 Region: 635-707
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000000471
Family VWC domain 0.022
Further Details:      
 
Domain Number 4 Region: 476-583
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.0000000424
Family Growth factor receptor domain 0.0085
Further Details:      
 
Domain Number 5 Region: 427-470
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000794
Family EGF-type module 0.014
Further Details:      
 
Domain Number 6 Region: 334-391
Classification Level Classification E-value
Superfamily FnI-like domain 0.00000492
Family VWC domain 0.034
Further Details:      
 
Domain Number 7 Region: 577-640
Classification Level Classification E-value
Superfamily FnI-like domain 0.0000921
Family VWC domain 0.024
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000011881
Domain Number - Region: 392-426
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00545
Family EGF-type module 0.038
Further Details:      
 
Domain Number - Region: 718-755
Classification Level Classification E-value
Superfamily FnI-like domain 0.00816
Family VWC domain 0.07
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011881   Gene: ENSMMUG00000009055   Transcript: ENSMMUT00000012668
Sequence length 763
Comment pep:known chromosome:MMUL_1:14:50285497:51219630:-1 gene:ENSMMUG00000009055 transcript:ENSMMUT00000012668 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPVDVILVVWFCVCTARTVVGFGMDPDLQMDIITELDLVNTTLGVAQVSGMHNASKAFLF
QDIEREIHAAPHVSEKLIQLFRNKSEFTFLATVQQKPSTSGVILSIRELEHSYFELESSG
LRDEIRYHYIHSGKPRTEALPYRMADGRWHKIALSVSASHLLLHVDCNRIYERVIDPPDT
NLPPGINLWLGQRNQKHGLFKGIIQDGKIIFMPNGYITQCPNLNRTCPTCSDFLSLVQGI
MDLQELLAKMTAKLNYAETRLSQLENCHCEKTCQVSGLLYRDQDSWVDGDHCRNCTCKSG
AVECRRMSCPPLNCSPDSLPVHIAGQCCKVCRPKCIYGGKVLAEGQRILTKSCRECRGGV
LVKITEMCPPLNCSEKDHILPENQCCRVCRGHNFCAEGPKCGENSECKNWNTKATCECKS
GYISVQGDSAYCEDIDECAAKMHYCHANTVCVNLPGLYRCDCVPGYIRVDDFSCTEHDEC
GSGQHNCDENAICTNTVQGHSCTCKPGYVGNGTICRAFCEEGCRYGGTCVAPNKCVCPSG
FTGSHCEKDIDECALRTHTCWNDSACINLAGGFDCLCPSGPSCSGDCPHEGGLKRNGQVW
TLKEDRCSVCSCKDGKIFCRRTACDCQNPSADLFCCPECDTRVTSQCLDQNGHKLYRSGD
NWTHSCQQCRCLEGEVDCWPLTCPNLSCEYTAILEGECCPRCVSDPCLADNIAYDIRKTC
LDSYGVSRLSGSVWTMAGSPCTTCKCKNGRVCCSVDLECLQNN
Download sequence
Identical sequences F7F740
ENSMMUP00000011881 XP_001092540.1.72884

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]