SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011882 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000011882
Domain Number 1 Region: 423-537,659-805
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 6.08e-64
Family Phosphate binding protein-like 0.00000000195
Further Details:      
 
Domain Number 2 Region: 29-408
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.14e-54
Family L-arabinose binding protein-like 0.01
Further Details:      
 
Domain Number 3 Region: 561-656
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.00000772
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011882   Gene: ENSMMUG00000009054   Transcript: ENSMMUT00000012669
Sequence length 894
Comment pep:known_by_projection chromosome:MMUL_1:X:121384627:121702090:1 gene:ENSMMUG00000009054 transcript:ENSMMUT00000012669 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARQKKMGQNVLRAVFFLVLGLLGHSHGGFPNTISIGGLFMRNTVQEHSAFRFAVQLYNT
NQNTTEKPFHLNYHVDHLDSSNSFSVTNAFCSQFSRGVYAIFGFYDQMSMNTLTSFCGAL
HTSFVTPSFPTDADVQFVIQMRPALKGAILSLLGHYKWEKFVYLYDTERGFSILQAIMEA
AVQNNWQVTARSVGNIKDVQEFRRIIEEMDRRQEKRYLIDCEVERINTILEQVVILGKHS
RGYHYMLANLGFTDILLERVMHGGANITGFQIVNNENPMVQQFIQRWVRLDEREFPEAKN
APLKYTSALTHDAILVIAEAFRYLRRQRVDVSRRGSAGDCLANPAVPWSQGIDIERALKM
VQVQGMTGNIQFDTYGRRTNYTIDVYEMKVSGSRKAGYWNEYERFVPFSDQQISNDSASS
ENRTIVVTTILESPYVMYKKNHEQLEGNERYEGYCVDLAYEIAKHVRIKYKLSIVGDGKY
GARDPETKIWNGMVGELVYGRADIAVAPLTITLVREEVIDFSKPFMSLGISIMIKKPQKS
KPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHLEDNNEEPRDPQSPPDPP
NEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLAAFLTVER
MVSPIESAEDLAKQTEIAYGTLDSGSTKEFFRRSKIAVYEKMWSYMKSAEPSVFTKTTAD
GVARVRKSKGKFAFLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGVATPKGSALRTPVNL
AVLKLSEQGILDKLKNKWWYDKGECGAKDSGSKDKTSALSLSNVAGVFYILVGGLGLAMM
VALIEFCYKSRAESKRMKLTKNTQNFKPAPATNTQNYATYREGYNVYGTESVKI
Download sequence
Identical sequences A0A2I3LKW6 A0A2K5MNX8 A0A2K6C374 G7Q3M1
9544.ENSMMUP00000011882 ENSMMUP00000011882 XP_005594554.1.63531 XP_005594556.1.63531 XP_011716869.1.29376 XP_011716870.1.29376 XP_011716871.1.29376 XP_011716872.1.29376 XP_011716874.1.29376 XP_011916556.1.92194 XP_011916558.1.92194 XP_014983614.1.72884 XP_014983615.1.72884 XP_014983616.1.72884 XP_014983618.1.72884 XP_015299447.1.63531 XP_015299449.1.63531 ENSMMUP00000011882

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]