SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000011883 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSMMUP00000011883
Domain Number - Region: 29-89
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.0565
Family L-arabinose binding protein-like 0.042
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000011883   Gene: ENSMMUG00000009054   Transcript: ENSMMUT00000012670
Sequence length 163
Comment pep:known_by_projection chromosome:MMUL_1:X:121384627:121404485:1 gene:ENSMMUG00000009054 transcript:ENSMMUT00000012670 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MARQKKMGQNVLRAVFFLVLGLLGHSHGGFPNTISIGGLFMRNTVQEHSAFRFAVQLYNT
NQNTTEKPFHLNYHVDHLDSSNSFSVTNASPAERDYLPWPGSIRENNWTALPRCKDHGLL
HLKCSPGPAKIGPLVSAVIKVNCKMRIRSQVSTTSSLLEFSTD
Download sequence
Identical sequences ENSMMUP00000011883

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]