SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012049 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012049
Domain Number 1 Region: 1-76
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000102
Family Voltage-gated potassium channels 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012049   Gene: ENSMMUG00000009187   Transcript: ENSMMUT00000012852
Sequence length 164
Comment pep:novel chromosome:MMUL_1:15:92933:130766:-1 gene:ENSMMUG00000009187 transcript:ENSMMUT00000012852 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
NFRTFLQALMLLFRSATGEAWHEIMLSCLSNQACDEQANATECGSDFAYFYFVSFIFLCS
FLMLNLFVAVIMDNFEYLTRDSSILGPHHLDEFIRVWAEYDPAACCRIHYKDMYSLLRCI
APPVGLGKNCPRRLAYKRLVRMNMPISSEDMTVHFTSTLMALIR
Download sequence
Identical sequences ENSMMUP00000012049

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]