SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012108 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012108
Domain Number 1 Region: 26-105
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000000543
Family I set domains 0.043
Further Details:      
 
Domain Number 2 Region: 128-197
Classification Level Classification E-value
Superfamily Immunoglobulin 0.000000006
Family I set domains 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012108   Gene: ENSMMUG00000009238   Transcript: ENSMMUT00000012917
Sequence length 258
Comment pep:known_by_projection chromosome:MMUL_1:13:102260883:102264127:1 gene:ENSMMUG00000009238 transcript:ENSMMUT00000012917 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGLWILAILTILVYSTAAKFSKQSWGLENEALIVRCPRQGKPSYIVDWYYSQTNKSIPTQ
ERNRVFASGQLLKFLPAEVADSGIYTCIVRSPTFNRTGYANVTIYKKQPDCNVPDYLMYS
TVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYKAHKSFLVIDNVMTDDAGDYT
CKFIHNENGANYSVTATRSFTVKEYYWKEVKVGTNLLFSNTHWIQSLMRGFMMRYYGVHK
CYCVDFNPCLYFQYHQWP
Download sequence
Identical sequences ENSMMUP00000012108

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]