SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012157 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012157
Domain Number 1 Region: 621-1038
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 4.08e-94
Family alpha-mannosidase, C-terminal domain 0.023
Further Details:      
 
Domain Number 2 Region: 248-516
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 7.56e-83
Family alpha-mannosidase 0.01
Further Details:      
 
Domain Number 3 Region: 517-618
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 1.31e-24
Family alpha-mannosidase, domain 2 0.01
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000012157
Domain Number - Region: 74-117
Classification Level Classification E-value
Superfamily Galactose-binding domain-like 0.0616
Family beta-Galactosidase/glucuronidase, N-terminal domain 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012157   Gene: ENSMMUG00000009279   Transcript: ENSMMUT00000012969
Sequence length 1042
Comment pep:known_by_projection chromosome:MMUL_1:7:54259952:54272412:-1 gene:ENSMMUG00000009279 transcript:ENSMMUT00000012969 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAPALKHWRTTVERVEKFVSPLYFTDCNLRGRLFGASCPVAALSSFLTPDRLPYQEAV
QRDFRPAQVGCSFGPTWWTCWFRVELTIPEAWVGQEVHLCWESDGEGLVWRDGEPVQDFR
TKEGSKTKASLSLRLSPHVCSLTLYVEVACNGLLGAGKGSIIAAPDPEKMFQLSRAELAV
FHRDVHMLLVDLELLLGIAKGLGKDNQRSFQALYTANQMVNVCDPAQPETFPVAQALASR
FFGQRGGESQHTIHATGHCHIDTAWLWPFKETMRKCARSWVTALQLMERNPEFIFACSQA
QQLEWVKNRYPGLHSRLQEFARRGQFVPVGGTWVEMDGNLPSGEAMVRQFLQGQNFFLQE
FGKMCSEFWLPDTFGYSAQLPQIMHGCGIRRFLTQKLSWNLVNSFPHHTFFWEGLDGSRV
LVHFPPGDSYGMQGSVEEVLKTVANNRDKGRANHSAFLFGFGDGGGGGPTQTMLDRLKRL
SNTDGLPRVQLSSPRQLFSALESDSGQLCTWVGELFLELHNGTYTTHAQIKKGNRECERI
LHDVELLSSLALARSAQFLYPAAQLQHLWRLLLLNQFHDVVTGSCIQIVAEEAMCHYEDI
RSHGNTLLSTAAAALCAGEPGPEGLLIVNTLPWKRTEVMALPKPGGAHSLALVTVPSMGY
APVPPPTSLQPLLPQQPVFVLQETDGSVTLDNGIIRVKLDPTGRLTSLVLVASGREAIAE
GAVGNQFVLFDDVPLYWDAWDVMDYHLETRKPVLGQAGTLAVGTEGGLRGSAWFLLQISP
NSRLSQEVVLDVGCPYVRFHTEVHWHEAHKFLKVEFPARVRSSQATYEIQFGHLQRPTHY
NTSWDWARFEVWAHRWMDLSEHGFGLALLNDCKYGASVQGSVLSLSLLRAPKAPDATADM
GRHEFTYALMPHKGSFQDAGVIQAAYSLNFPLLALPAPSPAPATSWSAFSLSSPAVVLET
VKQARGGIPQRRSLVLRLYEAHGSHVDCWLHLSLPVQEAILCDLLERPDPAGHLPLRDSR
LKLTFSPFQVLSLLLVLQPPPH
Download sequence
Identical sequences ENSMMUP00000012157 9544.ENSMMUP00000012157 ENSMMUP00000012157

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]