SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012166 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012166
Domain Number 1 Region: 312-426,546-692
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.52e-62
Family Phosphate binding protein-like 0.00000000254
Further Details:      
 
Domain Number 2 Region: 3-294
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.04e-44
Family L-arabinose binding protein-like 0.0061
Further Details:      
 
Domain Number 3 Region: 442-545
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0000204
Family Voltage-gated potassium channels 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012166   Gene: ENSMMUG00000009287   Transcript: ENSMMUT00000012980
Sequence length 811
Comment pep:known chromosome:MMUL_1:6:149996083:150164696:1 gene:ENSMMUG00000009287 transcript:ENSMMUT00000012980 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLTSFCGALHVCFITPSFPVDTSNQFVLQLRPELQDALISIIDHYKWQKFVYIYDADRGL
SVLQKVLDTAAEKNWQVTAVNILTTTEEGYRMLFQDLEKKKERLVVVDCESERLNAILGQ
IIKLEKNGIGYHYILANLGFMDIDLNKFKESGANVTGFQLVNYTDTIPAKIMQQWKNSDA
RDHTRVDWKRPKYTSALTYDGVKVMAEAFQSLRRQRIDISRRGNAGDCLANPAVPWGQGI
DIQRALQQVRFEGLTGNVQFNEKGRRTNYTLHVIEMKHDGIRKIGYWNEDDKFVPAATDA
QAGGDNSSVQNRTYIVTTILEDPYVMLKKNANQFEGNDRYEGYCVELAAEIAKHVGYSYR
LEIVSDGKYGARDPDTKAWNGMVGELVYGRADVAVAPLTITLVREEVIDFSKPFMSLGIS
IMIKKPQKSKPGVFSFLDPLAYEIWMCIVFAYIGVSVVLFLVSRFSPYEWHSEEFEEGRD
QTTSDQSNEFGIFNSLWFSLGAFMQQGCDISPRSLSGRIVGGVWWFFTLIIISSYTANLA
AFLTVERMVSPIESAEDLAKQTEIAYGTLEAGSTKEFFRRSKIAVFEKMWTYMKSAEPSV
FVRTTEEGMIRVRKSKGKYAYLLESTMNEYIEQRKPCDTMKVGGNLDSKGYGIATPKGSA
LRGPVNLAVLKLSEQGVLDKLKSKWWYDKGECGSKDSGSKDKTSALSLSNVAGVFYILIG
GLGLAMLVALIEFCYKSRSESKRMKGFCLIPQQSINEAIRTSTLPRNSGAGASSGGSGEN
GRVVSHDFPKSMQSIPCMSHSSGMPLGATGL
Download sequence
Identical sequences A0A0D9REM6 F7H3T7
NP_001244949.1.87134 NP_001244949.1.92137 ENSMMUP00000012166

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]