SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012237 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012237
Domain Number 1 Region: 47-132
Classification Level Classification E-value
Superfamily Immunoglobulin 1.52e-26
Family I set domains 0.0066
Further Details:      
 
Domain Number 2 Region: 131-222
Classification Level Classification E-value
Superfamily Immunoglobulin 2.02e-16
Family C2 set domains 0.027
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012237   Gene: ENSMMUG00000009343   Transcript: ENSMMUT00000013056
Sequence length 271
Comment pep:known_by_projection chromosome:MMUL_1:19:10099892:10101374:1 gene:ENSMMUG00000009343 transcript:ENSMMUT00000013056 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGSLFPLSLLLFLAAAYPGVGCALGRRIKRAQGPKGSPLAPSGTSVPFWVRMSPEFVAVP
PGRSVWLNCSNSCPQPQNSSLRTRLRQGKTLRGPGWVYYQLLDVRAWSSQAHCLVTCAGK
TRWATTRITAYKPPHSVILEPPVLKGRQYTLRCHVTHVFPVGYLVVTLRLGGRVIYSESL
ERYTHQDLANVTLTYEFPAGPRDFWQPLICHTRLNLEGLVVRNSSAPVTLMLAWSPAPTA
LASVSIAALVGILLAVGSVYLYKCLPMKSQA
Download sequence
Identical sequences ENSMMUP00000012237 9544.ENSMMUP00000012237 XP_001100946.1.72884 ENSMMUP00000012237

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]