SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012282 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012282
Domain Number 1 Region: 2-126
Classification Level Classification E-value
Superfamily PH domain-like 4.1e-29
Family GRAM domain 0.063
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012282   Gene: ENSMMUG00000009381   Transcript: ENSMMUT00000013104
Sequence length 261
Comment pep:known chromosome:MMUL_1:16:71165672:71175930:-1 gene:ENSMMUG00000009381 transcript:ENSMMUT00000013104 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MALNKNHSEGGGVIVNNTESILMSYDHVELTFNDMKNVPEAFKGTKKGTVYLTPYRVIFL
SKGKDAMQSFMMPFYLMKDCEIKQPVFGANYIKGTVKAEAGGGWEGSASYKLTFTAGGAI
EFGQRMLQVASQASRGEAPNGAYGYSYMPSGAYVYPPPVANGMYPCPPGYPYPPPPPEFY
PGPPMMDGAMGYVQPPPPPYPGPMEPPVSGPDVPSTPAAEAKAAEAAASAYYNPGNPHNV
YMPTSQPPPPPYYPPEDKKTQ
Download sequence
Identical sequences A0A2K6DQG4 A0A2K6PMX6 F7HF12 G7PSU3
9544.ENSMMUP00000012282 NP_001245028.1.72884 NP_001272096.1.63531 XP_010385870.1.97406 XP_011718184.1.29376 XP_015293348.1.63531 ENSMMUP00000012282 ENSMMUP00000012282

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]