SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012442 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012442
Domain Number 1 Region: 58-141
Classification Level Classification E-value
Superfamily Eukaryotic type KH-domain (KH-domain type I) 0.0000023
Family Eukaryotic type KH-domain (KH-domain type I) 0.0073
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000012442
Domain Number - Region: 460-544
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 0.0683
Family L-arabinose binding protein-like 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012442   Gene: ENSMMUG00000009516   Transcript: ENSMMUT00000013276
Sequence length 678
Comment pep:known chromosome:MMUL_1:7:87328804:87336472:1 gene:ENSMMUG00000009516 transcript:ENSMMUT00000013276 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPTWEARPASPDRFAVSAEAENKVREQQPHVERIFSVGVSVLPKDCPDNPHIWLQLEGPK
ENASRAKEYLKGLCSPELQDEIHYPPKLHCIFLGAQGFFLDCLAWSTSAHLVPRAPGTLM
ISGLTEAFVMAQSRVEELTERLSWDFTPGPSSGASQCTGVLRDFSALLQSPGDAHREALL
QLPLAVQEELLSLVQEASSGQGPGALASWEGRSSGLLRAQCQEERALPSDGRESLDTGSV
GPRDSRGARGDNYVVEKEGGKQGGPREMDLGWKELPGEEAWEREVALRPQSVGGGLRESA
PLKGKALGKEEVTQGGGGVCVHREPPGAHGSCHRAAQSRGASLLQRLHNGNASPPRVPSP
PPAPEPPWHCGDRGDWGDRGDGGDRGDKQQGMARGRGPQWKRGARGGNLVTGTQRFKEAL
QDPFTLCLANVPGQPDLRHIVIDGSNVAMVHGLQHYFSSRGIAIAVQYFWDRGHRDITVF
VPQWRFSKDSKVRESHFLQKLYSLSLLSLTPSRVMDGKRISSYDDRFMVKLAEETDGIIV
SNDQFRDLAEESEKWMAIIRERLLPFTFVGNLFMVPDDPLGRNGPTLDEFLKKPARTQGS
SKAQHPSRGFAEHGKQQHGREEEKGSGGIRKTRETERLRRQLLEVFWGQDHKVDFILQRE
PYCRDINQLSEALLSLNF
Download sequence
Identical sequences F6YMB3
XP_002805045.1.72884 XP_002805046.1.72884 XP_014998953.1.72884 ENSMMUP00000012442 9544.ENSMMUP00000012442 ENSMMUP00000012442

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]