SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012478 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012478
Domain Number 1 Region: 1099-1238
Classification Level Classification E-value
Superfamily PRC-barrel domain 2.04e-61
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.000000174
Further Details:      
 
Domain Number 2 Region: 224-317
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.000000667
Family Calponin-homology domain, CH-domain 0.0088
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012478   Gene: ENSMMUG00000009540   Transcript: ENSMMUT00000013316
Sequence length 1244
Comment pep:known chromosome:MMUL_1:19:7547217:7568679:1 gene:ENSMMUG00000009540 transcript:ENSMMUT00000013316 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AAPPGPGPLRRTFLPEIKSLDQYDFSRAKAAASLAWVLRAAFGGAEHVPELWEPFYTDQY
AQEHVKPPVTRLLLSAELYCRAWRQALPQLETPPNPSALLALLARRGTVPALPERPVREA
DLRHQPILMGAHLAVIDALMAAFAFEWTKTLPGPLALTSLEHKLLFWVDTTVRRLQEKTE
QEAAQRASPAAPADGAAQAQPSIRYRKDRVVARRAPCFPTVTSLQDLASGAALAATIHCY
CPQLLRLEEVCLKDPMSVADSLYNLQLVQDFCASRLPRGCPLSLEDLLYVPPPLKVNLVV
LLAELFMCFEVLKPDFVQVKDLPDGHAASPRGTEASPPQNNSGSSSPVFNFRHPLLSPGG
PQSPLRGSTGSLKSSPSMSHMEALGKAWNRQLSRPLSQAVSFSTPFGLDSDVDVVMGDPV
LLRSVSSDSLGPPRPAPARTPTQPPPEPGDLPTIEEALQIIHSAEPRLLPDGAADGSFYL
HSPEGPSKPSLASPYLPEGTSKPLSDRPTKAPVYMPHPETPSKPSPCLVGEASKLPAPSE
GSPKAVASSPAATNSEVKMTSFAERKKQLVKAEAEAGAGSPTSTPAPPEALSSEMSELGA
RLEEKRRAIEAQKRRIEAIFAKHRQRLGKSAFLQVQPREASGEAEAEAEPGSVPGGERPA
GEGQGEPTSRPKAVTFSPDLGPVPPEGLGEYNRAVSKLSAALSSLQRDMQRLTDQQQRLL
APPEAPGPAPPPAAWIIPGPTTGPKAASPSPARRVPTTRRSPGPGPSQSPRSPKHTRPAE
LRLAPLTRVLTPPHDVDSLPHLRKFSPSQVPVQTRSSILLAEETPPEEPTARPGLIEIPL
GSLADPAAEDEGDGSPAGAEDSLEEEASSEGEPRVGLGFFYKDEDKPEDEMAQKRASLLE
RQQRRVEEARRRKQWQEAEKEQRREEAARLAQEEAPGPAPPVSAVPVAPMATPAPAARAP
AEEEVGPRKGDFTRQEYERRAQLKLMDDLDKVLRPRAAGSGGPGRGGRRAPRPRSGCCDD
SALARSPARGLLGSRLSKIYSQSTLSLSTVANEAHNNLGVKRPTSRAPSPSGLMSPSRLP
GSRERDWENGSNASSPASVPEYTGPRLYKEPSAKSNKFIIHNALSHCCLAGKVNEPQKNR
ILEEIEKSKANHFLILFRDSSCQFRALYTLSGETEELSRLAGYGPRTVTPAMVEGIYKYN
SDRKRFTQIPAKTMSMSVDAFTIQGHLWQGKKPTTPKKGGSTPK
Download sequence
Identical sequences ENSMMUP00000012478 9544.ENSMMUP00000012478 ENSMMUP00000012478

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]