SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012564 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012564
Domain Number 1 Region: 664-949
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 4.24e-81
Family Protein kinases, catalytic subunit 0.000000000916
Further Details:      
 
Domain Number 2 Region: 250-335
Classification Level Classification E-value
Superfamily Immunoglobulin 5.08e-20
Family I set domains 0.0000871
Further Details:      
 
Domain Number 3 Region: 342-443
Classification Level Classification E-value
Superfamily Immunoglobulin 2.69e-19
Family I set domains 0.0000399
Further Details:      
 
Domain Number 4 Region: 93-166
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000023
Family I set domains 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012564   Gene: ENSMMUG00000004919   Transcript: ENSMMUT00000013409
Sequence length 1008
Comment pep:known_by_projection chromosome:MMUL_1:6:173597833:173605272:1 gene:ENSMMUG00000004919 transcript:ENSMMUT00000013409 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VCVCPCVCVCVSWPVSCALNAVCVTCPKSVAFALGVASAACGCAGVKERWLLQHASRGAC
ALHVWRVLCTQEAASDGAAGSADLCPLPTEPCLAPSMEQQEQELTVALGQPVRLCCGRAE
RGGHWYKEGSRLAPAGRVRGWRGRLEIASFLPEDAGRYLCLARASMIVLQNLTLTIDDSP
PATMMRTPSPIGTPRMGTFTPSKVSSSRTCVPAAHLITEKKRSVWEHTVILRAFLSPPAP
YWTHPQRMEKKLHAVPAGNTVKFRCPAAGNPTPTIRWLKDGQAFHGENRIGGIRLRHQHW
SLVMESVVPSDRGTYTCLVENAVGIIRYNYLLDVLERSPHRPILQAGLPANTTAVVGSDV
ELLCKVYSDAQPHIQWLKHIVINGSSFGADGFPYVQVLKTADINSSEVEVLYLRNVSAED
AGEYTCLAGNSIGLSYQSAWLTVLPGKHLQGQNMLRDAPLGQQWGLWSVGWSVSVGLWGL
PSGAVCGFVSLSCMAAPLCLSTCGCPCDPLLSMGLGITTASSVCVPTYAGSWEGLGHMGR
PVLPLTTWSVCVCSCARAEEDLTWTAATPEARYTDVILYASGSLALAVLLLLAGLYRGQA
LHGRHPRPPATVQKLSRFPLARQFSLESGSSSKSSSSLVRGVRLSSSGPALLAGLVSLDL
PLDPLWEFPRDRLVLGKPLGEGCFGQVVRAEAFGMDPARPDQASTVAVKMLKDNASDKDL
ADLVSEMEVMKLIGRHKNIINLLGVCTQEGPLYVIVECAAKGNLREFLRARRPPGPDLSP
DGPQSSEGPLAFPVLVSCAYQVARGMQYLESRKCIHRDLAARNVLVTEDNVMKIADFGLA
RGIHHIDYYKKTSNGRLPVKWMAPEALFDRVYTHQSDVWSFGVLLWEIFTLGGSPYPGIP
VEELFSLLREGHRMDRPPHCPPELYGLMRECWHAAPSQRPTFKQLVEALDKVLLAVSEEY
LDLRLTFGPYSPAGGDTSSTCSSSDSVFSHDPLPLGSSSFPFGSGVQT
Download sequence
Identical sequences 9544.ENSMMUP00000012564 ENSMMUP00000012564 ENSMMUP00000012564

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]