SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012661 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012661
Domain Number 1 Region: 31-413
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 6.73e-67
Family L-arabinose binding protein-like 0.0058
Further Details:      
 
Domain Number 2 Region: 434-547,666-805
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 1.63e-63
Family Phosphate binding protein-like 0.00000000288
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000012661
Domain Number - Region: 569-661
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000916
Family Voltage-gated potassium channels 0.018
Further Details:      
 
Domain Number - Region: 789-891
Classification Level Classification E-value
Superfamily Tetrahydrobiopterin biosynthesis enzymes-like 0.016
Family DHN aldolase/epimerase 0.031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012661   Gene: ENSMMUG00000009679   Transcript: ENSMMUT00000013514
Sequence length 919
Comment pep:known_by_projection chromosome:MMUL_1:1:39669524:39901945:-1 gene:ENSMMUG00000009679 transcript:ENSMMUT00000013514 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTAPWRRLRSLVWEYWAGLLVCAFWIPDSRGMPHVIRIGGIFEYADGPNAQVMNAEEHAF
RFSANIINRNRTLLPNTTLTYDIQRIHFHDSFEATKKACDQLALGVVAIFGPSQGSCTNA
VQSICNALEVPHIQLRWKHHPPDNKDTFYVNLYPDYASLSHAILDLVQYLKWRSATVVYD
DSTGLIRLQELIMAPSRYNIRLKIRQLPVDSDDSRPLLKEMKRGREFRIIFDCSHTMAAQ
ILKQAMAMGMMTEYYHFIFTTLDLYALDLEPYRYSGVNLTGFRILNVDNPHVSAIVEKWS
MERLQAAPRAESGLLDGVMMTDAALLYDAVHIVSVCYQRAPQMTVNSLQCHRHKAWRFGG
RFMNFIKEAQWEGLTGRIVFNKTSGLRTDFDLDIISLKEDGLEKVGVWSPADGLNITEAA
KGRGPNVTDSLTNRSLIVTTVLEEPFVMFRKSDRTLYGNDRFEGYCIDLLKELAHILGFS
YEIRLVEDGKYGAQDDKGQWNGMVKELIDHKADLAVAPLTITHVREKAIDFSKPFMTLGV
SILYRKPNGTNPSVFSFLNPLSPDIWMYVLLAYLGVSCVLFVIARFSPYEWYDAHPCNPG
SEVVENNFTLLNSFWFGMGSLMQQGSELMPKALSTRIIGGIWWFFTLIIISSYTANLAAF
LTVERMESPIDSADDLAKQTKIEYGAVKDGATMTFFKKSKISTFEKMWAFMSSKPSALVK
NNEEGIQRALTADYALLMESTTIEYVTQRNCNLTQIGGLIDSKGYGIGTPMGSPYRDKIT
IAILQLQEEDKLHIMKEKWWRGSGCPEEENKEASALGIQKIGGIFIVLAAGLVLSVLVAV
GEFVYKLRKTAEREQRSFCSTVADEIRFSLTCQRRVKHKPQPPMMVKTDAVINMHTFNDR
RLPGKDSMACSTSLAPVFP
Download sequence
Identical sequences ENSMMUP00000012661 9544.ENSMMUP00000012661 ENSMMUP00000012661

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]