SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012675 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012675
Domain Number 1 Region: 156-210,238-253,291-322
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 2.55e-24
Family N-terminal PAS domain of Pas kinase 0.054
Further Details:      
 
Domain Number 2 Region: 72-137
Classification Level Classification E-value
Superfamily HLH, helix-loop-helix DNA-binding domain 9.55e-17
Family HLH, helix-loop-helix DNA-binding domain 0.0024
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012675   Gene: ENSMMUG00000009690   Transcript: ENSMMUT00000013528
Sequence length 509
Comment pep:known chromosome:MMUL_1:14:58501923:58611209:-1 gene:ENSMMUG00000009690 transcript:ENSMMUT00000013528 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MADQRMDISSTISDFMSPGPTDLLSGSLGTSGVDCNRKRKGSSTDYQESMDTDKDDPHGR
LEYTEHQGRIKNAREAHSQIEKRRRDKMNSFIDELASLVPTCNAMSRKLDKLTVLRMAVQ
HMKTLRGATNPYTEANYKPTFLSDDELKHLILRAADGFLFVVGCDRGKILFVSESVFKIL
NYSQNDLIGQSLFDYLHPKDIAKVKEQLSSSDTAPRERLIDAKTGLPVKTDITPGPSRLC
SGARRSFFCRMKCNRPSVKVEDKDFPSTCSKKKVLQTREKITTNCYKFKIKDGSFITLRS
RWFSFMNPWTKEVEYIVSTNTVVLANVLEGGDPTFPQLTASPHSMDSMLPSGEGGPKRTH
PTVPGIPGGTRAGAGKIGRMIAEEIMEIHRQTLGSSPSSCGSSPLNITSTPPPDASSPGG
KKILNGGTPDIPSSGLLSGQAQENPGYPYSDSSSILGENPHIGIDMIDNDQGSSSPSNDE
AAMAVIMSLLEADAGLGGPVDFSDLPWPL
Download sequence
Identical sequences ENSMMUP00000012675

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]