SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012787 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012787
Domain Number 1 Region: 39-104
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 7.07e-16
Family Ovomucoid domain III-like 0.0046
Further Details:      
 
Domain Number 2 Region: 231-276
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000000000000907
Family EGF-type module 0.0057
Further Details:      
 
Domain Number 3 Region: 139-196
Classification Level Classification E-value
Superfamily Kazal-type serine protease inhibitors 0.0000000000347
Family Ovomucoid domain III-like 0.0049
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012787   Gene: ENSMMUG00000009775   Transcript: ENSMMUT00000013647
Sequence length 341
Comment pep:known_by_projection chromosome:MMUL_1:15:35637480:35769540:-1 gene:ENSMMUG00000009775 transcript:ENSMMUT00000013647 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLPEQLYFLQSPPEEEPEYHPDASAQELNVRESDVRVCDESSCKYGGVCKEDGDGLKCAC
QFQCHTNYIPVCGSNGDTYQNECFLRRAACKHQKEITVVARGPCYSDNGSGSGEGEEEGS
GAEVHRKHSKCGPCKYKAECDEDAENVGCVCNIDCSGYSFNPVCAFDGSSYNNPCFVREA
SCIKQEQIDIRHLGHCTDTDDNSLLGKKDDGLQYRPDVKDANDQREDVYIGNHMPCPENL
NGYCIHGKCEFIYSTQKASCRCESGYTGQHCEKTDFSILYVVPSRQKLTHVLIAAIIGAV
QIAIIVAIVMCITRKCPKNNRGRRQKQNLGHFTSDTSSRMV
Download sequence
Identical sequences ENSMMUP00000012787

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]