SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012909 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012909
Domain Number 1 Region: 2-104
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 9.77e-16
Family Phosphate binding protein-like 0.00000564
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012909   Gene: ENSMMUG00000029527   Transcript: ENSMMUT00000013775
Sequence length 215
Comment pep:novel chromosome:MMUL_1:4:97994132:98028016:1 gene:ENSMMUG00000029527 transcript:ENSMMUT00000013775 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
KSKISTYDKMWAFMSSRRQSVLVKSNEEGIQRVLTSDYAFLMESTTIEFVTQRNCNLTQI
GGLIDSKGYGVGTPMGRLYRELMRIAIFKAEEYGKLNIYVDRWDRENSISWSNILKSEVV
EVQNLHCTFVLDIMGLGTEHSLFLRSGNFLYFNNKETIKEKRSFCSAMVEELRMSLKCQR
RLKHKPQAPVIVKTEEVINMHTFNDRRLPGKETMA
Download sequence
Identical sequences ENSMMUP00000012909 9544.ENSMMUP00000012909 ENSMMUP00000012909

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]