SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012910 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012910
Domain Number 1 Region: 360-474,593-733
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.82e-66
Family Phosphate binding protein-like 0.00000000105
Further Details:      
 
Domain Number 2 Region: 2-340
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.51e-64
Family L-arabinose binding protein-like 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000012910
Domain Number - Region: 443-588
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000589
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012910   Gene: ENSMMUG00000004886   Transcript: ENSMMUT00000013776
Sequence length 834
Comment pep:known_by_projection chromosome:MMUL_1:3:16963764:17120400:1 gene:ENSMMUG00000004886 transcript:ENSMMUT00000013776 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNTTLTYDIQRINLFDSFEASRRACDQLALGVAALFGPSHSSSVSAVQSICNALEVPHI
QTRWKHPSVDNKDLFYINLYPDYAAISRAILDLVLYYNWKTVTVVYEDSTGLIRLQELIK
APSRYNIKIKIRQLPSGNKDAKPLLKEMKKGKEFYVIFDCSHETAAEILKQILFMGMMTE
YYHYFFTTLDLFALDLELYRYSGVNMTGFRLLNIDNPHVSSIIEKWSMERLQAPPRPETG
LLDGMMTTEAALMYDAVYMVAIASHRASQLTVSSLQCHRHKPWRLGPRFMNLIKEARWDG
LTGHITFNKTNGLRKDFDLDIISLKEEGTEKIGIWNSNSGLNMTDSNKDKSSNITDSLAN
RTLIVTTILEEPYVMYRKSDKPLYGNDRFEGYCLDLLKELSNILGFIYDVKLVPDGKYGA
QNDKGEWNGMVKELIDHRADLAVAPLTITYVREKVIDFSKPFMTLGISILYRKPNGTNPG
VFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCNPDSDVVENNFTLLNS
FWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLAAFLTVERMESPIDSA
DDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTALVRNSDEGIQRVLTT
DYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRDKITIAILQLQEEGKL
HMMKEKWWRGNGCPEEDNKEASALGVENIGGIFIVLAAGLVLSVFVAIGEFIYKSRKNND
IEQCLSFNAIMEELGISLKNQKKIKKKSRTKGKSSFTSILTCHQRRTQRKETVA
Download sequence
Identical sequences A0A2K5M946 A0A2K6KRD0
ENSMMUP00000012910

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]