SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012959 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012959
Domain Number 1 Region: 32-257
Classification Level Classification E-value
Superfamily Heme oxygenase-like 5.34e-74
Family Eukaryotic type heme oxygenase 0.00000045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012959   Gene: ENSMMUG00000009901   Transcript: ENSMMUT00000013829
Sequence length 316
Comment pep:known chromosome:MMUL_1:20:4640988:4677896:1 gene:ENSMMUG00000009901 transcript:ENSMMUT00000013829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEVETSEGVDESEKKNSGALEKENQMRMADLSELLKEGTKEAHDRAENTQFVKDFLKG
NIKKELFKLATTALYFTYSALEEEMERNKDHPAFAPLYFPMELHRKEALTKDMEYFFGEN
WEEQVQCPKAAKKYVERIHYIGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPST
GEGTQFYLFENVDNAQQFKQLYRARMNALDLNMKTKERIVEEANKAFEYNMQIFNELDQA
GSTLARETLEDGFPVHDGKGDMRKCPFYAGEQDKGALEGSSCPFRTAMAVLRKPSLQFIL
AAGMALAAGLLAWYYM
Download sequence
Identical sequences A0A2K5HLX3 A0A2K5XHM8 A0A2K6B769 G7Q0E3 I0FKU7
ENSMMUP00000012959 ENSMMUP00000012959 9544.ENSMMUP00000012959 NP_001252998.1.72884 XP_011715891.1.29376 XP_011715892.1.29376 XP_011715893.1.29376 XP_011715894.1.29376 XP_011715895.1.29376 XP_011715896.1.29376 XP_011715897.1.29376 XP_011816717.1.43180 XP_011816718.1.43180 XP_011816719.1.43180 XP_011816720.1.43180 XP_011816721.1.43180 XP_011816722.1.43180 XP_011833866.1.47321 XP_011833868.1.47321 XP_011833869.1.47321 XP_011833870.1.47321 XP_014980970.1.72884 XP_014980971.1.72884 XP_014980972.1.72884 XP_015297652.1.63531 XP_015297654.1.63531 XP_015297655.1.63531 XP_015297656.1.63531 XP_015297657.1.63531

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]