SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012967 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012967
Domain Number 1 Region: 128-386
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 1.66e-81
Family Eukaryotic proteases 0.00000000126
Further Details:      
 
Domain Number 2 Region: 25-123
Classification Level Classification E-value
Superfamily Kringle-like 1.88e-29
Family Kringle modules 0.00000876
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012967   Gene: ENSMMUG00000009906   Transcript: ENSMMUT00000013839
Sequence length 394
Comment pep:known chromosome:MMUL_1:9:63098113:63103152:-1 gene:ENSMMUG00000009906 transcript:ENSMMUT00000013839 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALLAHLLLCVLVVSDSKGSRELQVPYKSKTCYEGNGHFYRGKASTDTMGRSCLAWNSA
TVLQQTYHAHRSDALQLGLGKHNYCRNPDNRRRPWCYVQVGLKQLVQECMVQNCADGKKP
SSPPEELQFQCGQRTLRPRFKIVGGEFTTIENQPWFAAIYRRHRGGSVTYVCGGSLISPC
WVVSATHCFINYPKKEDYIVYLGRSRLNSNTQGEMKFEVENLILHEDYSADTLAHHNDIA
LLKIRSKEGRCAQPSRTIQTICLPSTYNDPPFGTSCEITGFGKENSTDYLYPERLKMTVV
KLVSHQKCQQPHYYGSEVTTKMLCAADPQWETDSCQGDSGGPLVCSIQGHMTLTGIVSWG
RGCALKDKPGVYTRVSRFLPWIHSHTREENGLAL
Download sequence
Identical sequences ENSMMUP00000012967

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]