SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000012988 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000012988
Domain Number 1 Region: 146-341
Classification Level Classification E-value
Superfamily E set domains 1.45e-77
Family Cytoplasmic domain of inward rectifier potassium channel 0.000000376
Further Details:      
 
Domain Number 2 Region: 38-162
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 1.46e-23
Family Voltage-gated potassium channels 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000012988   Gene: ENSMMUG00000009928   Transcript: ENSMMUT00000013861
Sequence length 393
Comment pep:known chromosome:MMUL_1:1:138706864:138710599:1 gene:ENSMMUG00000009928 transcript:ENSMMUT00000013861 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAQENAAFSPGPEEPPRRRGRQRYVEKDGRCNVQQGNVRETYRYLTDLFTTLVDLQWRLS
LLFFVLAYALTWLFFGAIWWLIAYGRGDLEHLEDTAWTPCVNNLNGFVAAFLFSIETETT
IGYGHRVITDQCPEGIVLLLLQAILGSMVNAFMVGCMFVKISQPNKRAATLVFSSHAVVS
LRDGRLCLMFRVGDLRSSHIVEASIRAKLIRSRQTLEGEFIPLHQTDLSVGFDTGDDRLF
LVSPLVISHEIDAASPFWEASRRALERDDFEIVVILEGMVEATGMTCQARSSYLVDEVLW
GHRFTSVLTLEDGFYEVDYASFHETFEVPTPSCSARELAEAAARLDAHLYWSIPSRLDEK
VEEEGAGEGAGGEAGADKEQNGCLPPPESESKV
Download sequence
Identical sequences A0A096N4D9 A0A2K5L6M1 A0A2K6LEI7 A0A2K6RVD8
XP_001117363.1.72884 XP_007974723.1.81039 XP_007974724.1.81039 XP_007974725.1.81039 XP_007974726.1.81039 XP_007974727.1.81039 XP_007974728.1.81039 XP_007974729.1.81039 XP_007974730.1.81039 XP_011923055.1.92194 XP_011923056.1.92194 ENSMMUP00000012988 ENSPANP00000018258 ENSMMUP00000012988 9544.ENSMMUP00000012988

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]