SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013030 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013030
Domain Number 1 Region: 44-115
Classification Level Classification E-value
Superfamily Ribosomal protein L11, C-terminal domain 1.24e-17
Family Ribosomal protein L11, C-terminal domain 0.0045
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000013030
Domain Number - Region: 1-53
Classification Level Classification E-value
Superfamily Ribosomal L11/L12e N-terminal domain 0.000418
Family Ribosomal L11/L12e N-terminal domain 0.001
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013030   Gene: ENSMMUG00000009964   Transcript: ENSMMUT00000013906
Sequence length 131
Comment pep:novel chromosome:MMUL_1:1:96931553:96932050:-1 gene:ENSMMUG00000009964 transcript:ENSMMUT00000013906 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPLKFDPSEIKVINLRGTGGEVGATSVLVPRSAPWAKIEVVLSASALIIKALKESPRDRK
KQKNIKHSGNITFDEIVNIARQMQHQSLARELSGTIKEILGTAQSVGCNVDGRHPHDIID
INSCAVEGPAS
Download sequence
Identical sequences ENSMMUP00000013030 9544.ENSMMUP00000013030 ENSMMUP00000013030

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]