SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013095 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013095
Domain Number 1 Region: 359-592
Classification Level Classification E-value
Superfamily HCP-like 2.01e-48
Family HCP-like 0.00017
Further Details:      
 
Domain Number 2 Region: 566-700
Classification Level Classification E-value
Superfamily HCP-like 9.02e-27
Family HCP-like 0.0059
Further Details:      
 
Domain Number 3 Region: 199-323
Classification Level Classification E-value
Superfamily HCP-like 3.14e-24
Family HCP-like 0.0031
Further Details:      
 
Domain Number 4 Region: 117-170
Classification Level Classification E-value
Superfamily Kringle-like 4.28e-20
Family Fibronectin type II module 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013095   Gene: ENSMMUG00000010016   Transcript: ENSMMUT00000013983
Sequence length 794
Comment pep:known_by_projection chromosome:MMUL_1:7:144664629:144732072:-1 gene:ENSMMUG00000010016 transcript:ENSMMUT00000013983 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRVRIGLTLLLCAVLLSSASASSDEEGSQDESLDSKTTLTSDESVKDHTTAGRVVAGQIF
LDSEESELESSIQEEEDSLKSQEGESVTEDLSFLESPNPENKDNEEPKKVRKPALTAIEG
TAHGEPCHFPFLFLDKEYDECTSDGREDGRLWCATTYDYKADEKWGFCETEEEAAKRRQM
QEAEMMYQTGMKILNGSNKKSQKREAYRYLQKAAGMNHTKALERVSYALLFGDYLPQNIQ
AAREMFEKLTEEGSPKGQTALGFLYASGLGVNSSQAKALVYYTFGALGGNLIAHMVLGYR
YWAGIGVLQSCESALTHYHLVANHVASDISLTGGSVVQRIRLPDEVENPGMNSGMLEEDL
IQYYQFLAEKGDVQAQVGLGQLHLHGGRGVEQNHQRAFDYFNLAANAGNSHAMAFLGKMY
SEGSDIVPQSNETALHYFKKAADMGNPVGQSGLGMAYLYGRGVQVNYDLALKYFQKAAEQ
GWVDGQLQLGSMYYNGIGVKRDYKQALKYFNLASQGGHILAFYNLAQMHASGTGVMRSCH
TAVELFKNVCERGRWSERLMTAYNSYKDGDYNAAVIQYLLLAEQGYEVAQSNAAFILDQR
EATIVGENETYPRALLHWNRAASQGYTVARIKLGDYHFYGFGTDVDYETAFIHYRLASEQ
QHSAQAMFNLGYMHEKGLGIKQDIHLAKRFYDMAAEASPDAQVPVFLALCKLGVVYFLQY
IRETNIRDMFTQLDMDQLLGPEWDLYLMTIIALLLGTVIAYRQRQHQDLPAPRPPGPRPA
PPQQEAPPEQQPPQ
Download sequence
Identical sequences F6QKZ6
9544.ENSMMUP00000013095 XP_001105925.1.72884 ENSMMUP00000013095 ENSMMUP00000013095

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]