SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013253 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013253
Domain Number 1 Region: 113-211
Classification Level Classification E-value
Superfamily Immunoglobulin 1.87e-24
Family I set domains 0.0000535
Further Details:      
 
Domain Number 2 Region: 16-111
Classification Level Classification E-value
Superfamily Immunoglobulin 6.06e-24
Family I set domains 0.0013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013253   Gene: ENSMMUG00000010125   Transcript: ENSMMUT00000014151
Sequence length 211
Comment pep:novel scaffold:MMUL_1:1099214727108:1776:4427:-1 gene:ENSMMUG00000010125 transcript:ENSMMUT00000014151 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GFFLVQRACPHTGGQDKTFLFARPSAVVPQGGHVTLRCYYRDGLNNFTNFTLYKDDRSHV
PVFHSRIFQESFLMGPVTPAHAGTYRCRGSYPHSPTEWSALSDPLAIRVTGVHRKPSLLA
LPGPLVKSGETVTLQCSSDMVFEHFFLHSEVNFEKPLHLVGELHGGGSQANYSINSTTSD
LAGTYRCYGSVTHSDYVLSAPSDPLDIVITG
Download sequence
Identical sequences ENSMMUP00000002021 ENSMMUP00000013253 9544.ENSMMUP00000013253

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]