SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013265 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013265
Domain Number 1 Region: 451-559,681-797
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.8e-55
Family Phosphate binding protein-like 0.00000000804
Further Details:      
 
Domain Number 2 Region: 36-391
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.21e-23
Family L-arabinose binding protein-like 0.01
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013265   Gene: ENSMMUG00000010142   Transcript: ENSMMUT00000014163
Sequence length 1418
Comment pep:known chromosome:MMUL_1:20:9894964:10298429:-1 gene:ENSMMUG00000010142 transcript:ENSMMUT00000014163 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGRVGYWTLLVLPALLVWRGPAPSAAAEKGSPALNIAVMLGHSHDMTERELRTLWGPEQA
AGLPLDVNVVALLMNRTDPKSLITHVCDLMSGARIHGLVFGDDTDQEAVAQMLDFISSQT
FIPILGIHGGASMIMADKDPTSTFFQFGASIQQQATVMLKIMQDYDWHVFSLVTTIFPGY
RDFISFVKTTVDNSFVGWDMQNVITLDTSFEDAKTQVQLKKIHSSVILLYCSKDEAVLIL
SEARSLGLTGYDFFWIVPSLVSGNTELIPKEFPSGLISVSYDDWDYTLEARVRDGIGILT
TAASSMLEKFSYIPEAKASCYGQMERPEIPMHTLHPFMVNVTWDGKDLSFTEEGYQVHPR
LVVIVLNKDREWEKVGKWENQTLSLRHAVWPRYKSFSDCEPDDNHLSIVTLEEAPFVIVE
DIDPLTETCVRNTVPCRKFVKINNSTNEGMNVKKCCKGFCIDILKKLSRTVKFTYDLYLV
TNGKHGKKVNNVWNGMIGEVVYQRAVMAVGSLTINEERSEVVDFSVPFVETGISVMVSRS
NGTVSPSAFLEPFSASVWVMMFVMLLIVSAIAVFVFEYFSPVGYNRNLAKGKAPHGPSFT
IGKAIWLLWGLVFNNSVPVQNPKGTTSKIMVSVWAFFAVIFLASYTANLAAFMIQEEFVD
QVTGLSDKKFQRPHDYSPPFRFGTVPNGSTERNIRNNYPYMHQYMTKFNQKGVEDALVSL
KTGKLDAFIYDAAVLNYKAGRDEGCKLVTIGSGYIFATTGYGIALQKGSPWKRQIDLALL
QFVGDGEMEELETLWLTGICHNEKNEVMSSQLDIDNMAGVFYMLAAAMALSLITFIWEHL
FYWKLRFCFTGVCSDRPGLLFSISRGIYSCIHGVHIEEKKKSPDFNLTGSQSNMLKLLRS
AKNISNMSNMNSSRMDSPKRAADFIQRGSLIMDMVSDKGNMMYSDNRSFQGKESIFGDNM
NELQTFVANRHKDNLNNYVFQGQHPLTLNESNPNTVEVAVSTESKVNSRPRQLWKKSMDS
IRQDSLSQNPVSQRDEGTAENRTHSLKSPRYLPEEMAHSDVSETSNRATCHREPDNSKNH
KTKDNFKRSVASKYPKDCSEVERTYLKTKSSSPRDKIYTIDGEKEPGFHLDPPQFVENVT
LPENVDFPDPYQDHSENFRKGDSTLPMNRKPLHNEEGLPDTEQYKLYSKHFTLKDKGSPH
SETSERYRQNSTHCRSCLSNLPTYSGHFTMRSPFKCDACLRMGNLYDIDEDQMLQETGNP
ATREQVYQQDWAQNNALQLQKNKLRISRQHSYDNILLFPQGLEDSKRSKSLLPDHTSDNP
FLHSHRDDQRLVIGRCPSDPYKHSLPSQAVNDSYLRSSLRSTASYCSRDSRGHNDVYISE
HVMPYAANKNNMYSTPRVLNSCSNRRVYKKMPSMESDV
Download sequence
Identical sequences 9544.ENSMMUP00000013265 ENSMMUP00000013265 ENSMMUP00000013265

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]