SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013315 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013315
Domain Number 1 Region: 1-192
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.61e-43
Family L-arabinose binding protein-like 0.000000229
Further Details:      
 
Weak hits

Sequence:  ENSMMUP00000013315
Domain Number - Region: 203-249
Classification Level Classification E-value
Superfamily TNF receptor-like 0.00129
Family TNF receptor-like 0.037
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013315   Gene: ENSMMUG00000010184   Transcript: ENSMMUT00000014217
Sequence length 813
Comment pep:known chromosome:MMUL_1:14:86696777:86840967:-1 gene:ENSMMUG00000010184 transcript:ENSMMUT00000014217 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DGWADRYDVTDGYQREAVGGITIKLQSPDVKWFDDYYLKLRPETNHRNPWFQEFWQHRFQ
CRLEGFPQENSKYNKTCDSSLTLKTHHVQDSKMGFVINAIYSMAYGLHNMQMSLCPGYAG
LCDAMKPIDGRKLLESLMKTNFTGVSGDMILFDENGDSPGRYEIMNFKEMGKDYFDYINV
GSWDNGELKMDDDEVWSKKSNIIRSVCSEPCEKGQIKVIRKGEVSCCWTCTPCKENEYVF
DEYTCKACQLGSWPTDDLTGCDLIPVQYLRWGDPEPIAAVVFACLGLLATLFVTVVFIIY
RDTPVVKSSSRELCYIILAGICLGYLCTFCLIAKPKQIYCYLQRIGIGLSPAMSYSALVT
KTNRIARILAGSKKKICTKKPRFMSACAQLVIAFILICIQLGIIVALFIMEPPDIMHDYP
SIREVYLICNTTNLGVVTPLGYNGLLILSCTFYAFKTRNVPANFNEAKYIAFTMYTTCII
WLAFVPIYFGSNYKIITMCFSVSLSATVALGCMFVPKVYIILAKPERNVRSAFTTSTVVR
MHVGDGKSSSAASRSSSLVNLWKRRGSSGETLSSNGKSVTWAQNEKSSRGQHLWQRLSIH
INKKENPNQTAVIKPFPKSTESRGLGAGAGAGGSAGGMGATGGAGCAGAGPGGPEPPDAS
PKGLYDVAETEEHFPAPTQPRSPSPISTLSHRAGSASRTDDDVPSLHSEPAARSSSSQGS
LMEQISSVVTRFTANISELNSMMLSTAAPSPGVGAPLCSSYLIPKEIQLPTTMTTFAEIQ
PLPAIEVTGGAQPAAGAQAGDAARESPAAGPEA
Download sequence
Identical sequences ENSMMUP00000013315

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]