SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013469 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013469
Domain Number 1 Region: 2-77
Classification Level Classification E-value
Superfamily SRCR-like 0.00000000000405
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0066
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013469   Gene: ENSMMUG00000016658   Transcript: ENSMMUT00000014379
Sequence length 256
Comment pep:known_by_projection chromosome:MMUL_1:8:23402260:23422152:-1 gene:ENSMMUG00000016658 transcript:ENSMMUT00000014379 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVVCRQLGLGFASNAFQETWYWHGDVYANKVVMSGVKCSGTELSLAHCRHDGEDVACPQG
GVQYGAGVACSETAPDLVLNAEMVQQTTYLEDRPMFMLQCAMEENCLSASAAQTNPTTGY
RRLLRFSSQIHNNGQSDFRPKNGRHAWIWHDCHRHYHSMEVFTHYDLLNLNGTKVAEGHK
ASFCLEDTECEGDIQKNYECANFGDQGITMGCWDMYRHDIDCQWIDITDVPPGDYLFQVV
PSVKRRKKSLSTSAGS
Download sequence
Identical sequences ENSMMUP00000013469

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]