SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013470 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013470
Domain Number 1 Region: 30-136
Classification Level Classification E-value
Superfamily SRCR-like 2.49e-38
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00017
Further Details:      
 
Domain Number 2 Region: 307-411
Classification Level Classification E-value
Superfamily SRCR-like 3.14e-35
Family Scavenger receptor cysteine-rich (SRCR) domain 0.00013
Further Details:      
 
Domain Number 3 Region: 419-536
Classification Level Classification E-value
Superfamily SRCR-like 1.96e-23
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0018
Further Details:      
 
Domain Number 4 Region: 172-293
Classification Level Classification E-value
Superfamily SRCR-like 4.84e-22
Family Scavenger receptor cysteine-rich (SRCR) domain 0.0048
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013470   Gene: ENSMMUG00000010285   Transcript: ENSMMUT00000014380
Sequence length 754
Comment pep:known_by_projection chromosome:MMUL_1:9:97837741:97851571:-1 gene:ENSMMUG00000010285 transcript:ENSMMUT00000014380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAWSPPATFSLFLLLLGQPPPSRPQSLGTTKLRLVGPESKPEEGRLEVLHQGQWGTVCDD
SFALQEATVACRQLGFEAALTWAHSAKYGQGEGPIWLDNVRCVGTESSLDQCGSNGWGVS
DCSHSEDVGVICHPRRHRGYLSETVSNALGPQGRRLEEVRLKPILASAKQHSPVTEGAVE
VKYEGHWRQVCDQGWTMNNSRVVCGMLGFPSEVPVDSHYYRKVWDLKMRDPKSRLKSLTN
KNSFWIHQVTCLGTEPHMANCQVQVAPVRGKLQPACPGGMHAVVSCVAGPRFRPPKTKPQ
RKGSRAEELRVRLRSGAQVGEGRVEVLVNRQWGTVCDHRWNLISASVVCRQLGFGSAREA
LFGARLGQGLGPIHLSEVRCRGYERTLSDCPALEGSQNGCQHENDAAVRCNVPNMGFQNQ
VRLAGGRIPEEGLLEVQVEVNGVPRWGSVCSENWGLTEAMVACRQLGLGFAIHAHKETWY
WSEMPRAQEVVMSGVRCSGTELALQQCQRHGPVHCSHGGGRFLAGVSCMDSAPDLVMNAQ
LVQETAYLEDRPLSQLYCAHEENCLSKSADHMDWPYGYRRLLRFSTQIYNLGRTDFRPKT
GRESWVWHQCHRHYHSIEVFTHYDLLTLNGSKVAEGHKASFCLEDTNCPTGLQRRYACAN
FGEQGVTVGCWDTYRHDIDCQWVDITDVGPGNYIFQVRISHIGEVTLKLDRANLGLNCGK
VGCLPVFLWPTGNSYPASAELSLEQEQRLRNNLI
Download sequence
Identical sequences ENSMMUP00000013470 ENSMMUP00000013470 9544.ENSMMUP00000013470

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]