SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013487 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013487
Domain Number 1 Region: 234-327
Classification Level Classification E-value
Superfamily Immunoglobulin 7.1e-20
Family I set domains 0.0065
Further Details:      
 
Domain Number 2 Region: 339-381
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000599
Family EGF-type module 0.0077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013487   Gene: ENSMMUG00000010301   Transcript: ENSMMUT00000014399
Sequence length 833
Comment pep:known_by_projection chromosome:MMUL_1:6:136258951:136456579:-1 gene:ENSMMUG00000010301 transcript:ENSMMUT00000014399 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRQVCCSALPPPPLEKGRCSSYSDSSSSSSSERSSSSSSESGGSSRSSSNNSSISRPAAP
PEPRPQQQPQPRSSAARRAAARSLAAAAGGMRRDPAPGFSMLLFGVSLACYSPSLKSVQD
QAYKAPVVVEGKVQGLAPAGGSSSNSTREPPASGRVALVKVLDKWPLRSGGLQREQVISV
GSCAPLERNQRYIFFLEPTEQPLVFKTAFAPLDTNGKNLKKEVGKILCTDCATRPKLKKM
KSQTGQVGEKQSLKCEAAAGNPQPSYRWFKDGKELNRSRDIRIKYGNGRKNSRLQFNKVK
VEDAGEYVCEAENILGKDTVRGRLYVNSVSTTLSSWSGHARKCNETAKSYCVNGGVCYYI
EGINQLSCKCPNGFFGQRCLEKLPLRLYMPDPKQKAEELYQKRVLTITGICVALLVVGIV
CVVAYCKTKKQRKQMHNHLRQNMCPAHQNRSLANGPSHPRLDPEEIQMADVTTDHVIRRE
TETFSGSHSCSPSHHCSTATPTSSHRHESHTWSLERSESLTSDSQSGIMLSSVGTSKCNS
PACVEARARRAAAYNLEERRRATVPPYHDSVDSLRDSPHSERSVPTPWPMPSPLSQRAGT
TGPRLTLRAPQKHSEDLANMVKPLSLLKIQKLAGHEAPYGESQGPAPLPPCSALSAAYGN
YYYPAAGPGPRRGTCALGGSLGSLPATPFRIPEDDEYETTQECAPPPPRPRARGASRRTS
AGPRRWRRSRLNGLAAQRARAARDSLSLSSGSGGGSASASDDDADDADGALAAESTPFLG
LRAAHDALRSDSPPLCPAADSRTYYSLDSHSTRASSRHSRGPPPRAKQDSAPL
Download sequence
Identical sequences ENSMMUP00000013487

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]