SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013565 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013565
Domain Number 1 Region: 353-443
Classification Level Classification E-value
Superfamily Immunoglobulin 9.56e-22
Family I set domains 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013565   Gene: ENSMMUG00000010352   Transcript: ENSMMUT00000014480
Sequence length 447
Comment pep:known chromosome:MMUL_1:1:80761206:80778081:1 gene:ENSMMUG00000010352 transcript:ENSMMUT00000014480 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
DDELESEAKKESLSPGKLKLTFEELERQRQENRKKQAEEEARKRLEEEKRAFEEARRQMV
NEEEENQDTAKIFKGYRPGKLKLSFEEIERQRREDEKRKAEEEARRRIEEEKKAFAEARR
NMVVDYDSPEMYKTVSQESLTPGKLEINFEELLKQKMEEEKRRTEEERKHKLEMEKQEFE
QLRQEMGEEEEENETFGLSREYEELIKLKRSGSIQAKNLKSKFEKIGQLSEKEIQKKIEE
ERARRRAIDLEIKAREAENFHEEDDVDVRPARKSEAPFTHKVNMKARFEQMAKAREEEEQ
RRIEEQKLLRMQFEQREIDAALQKKSEEEEEEEGSIMNGSTTEDEEQTRSGAPWFKKPLK
NTSVVDSEPVRFTVKVTGEPKPEITWWFEGEILQDGEDYQYIERGETYCLYLPETFPEDG
GEYMCKAVNNKGSAASTCILTIETDDY
Download sequence
Identical sequences ENSMMUP00000013565

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]