SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013591 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013591
Domain Number 1 Region: 1-61
Classification Level Classification E-value
Superfamily Metallothionein 5.96e-22
Family Metallothionein 0.0000228
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013591   Gene: ENSMMUG00000010370   Transcript: ENSMMUT00000014508
Sequence length 61
Comment pep:novel chromosome:MMUL_1:20:55030104:55036966:1 gene:ENSMMUG00000010370 transcript:ENSMMUT00000014508 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDPKCSCAAGGSCTCAGSCKCKECTCTSCKKSCCSCCPVGCAKCAQGCVCKGTSDRCSGC
A
Download sequence
Identical sequences ENSMMUP00000013591 ENSMMUP00000013591

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]