SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013679 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013679
Domain Number 1 Region: 1548-1829
Classification Level Classification E-value
Superfamily Protein kinase-like (PK-like) 7.65e-59
Family MHCK/EF2 kinase 0.0046
Further Details:      
 
Domain Number 2 Region: 276-369
Classification Level Classification E-value
Superfamily Immunoglobulin 2.41e-19
Family I set domains 0.0042
Further Details:      
 
Domain Number 3 Region: 1477-1563
Classification Level Classification E-value
Superfamily Immunoglobulin 0.0000000792
Family I set domains 0.057
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013679   Gene: ENSMMUG00000010434   Transcript: ENSMMUT00000014601
Sequence length 1907
Comment pep:known_by_projection chromosome:MMUL_1:7:64418657:64480210:-1 gene:ENSMMUG00000010434 transcript:ENSMMUT00000014601 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKVAGLVDVLGQQPLARQGEGQSRLVPGRGPVLWLPGLLRSSSSWPAVDLPLAPARPRGP
LICKTGHEQGRKASREPGPGSSTKGPVLVSMSRCAFLPRLPGPRPTRRCCRHQARGAGSA
LGANSGAGAARRPPRVSEPRCPGRPGEGQQQVTTAWPPAINRGSRQPRAGAAAAGRGPEA
GAWRTGEAGAGGPAVGEGGAMGSRRAPSRGWGAGGRSGAGGDSEDDGPVWIPSPASRSYL
LSVRPETSLSSNRLSHPSSGRSTFCSIIAQLTEETQPLFETTLKSRAVCEDSDVRFTCIV
TGYPEPEVTWYKDDTELDRYCGLPKYEITHQGNRHTLQLYRCREEDAAIYQASAQNSKGI
VSCSGVLEVGTMTEYKIHQRWFAKLKRKAAAKLREIEQSWKQEKAAPGEADTLRKLSPDR
FQRKRRLSGAEALDPSVPTREPEGGTLAVWQEGETESAQHSGLGLINSFASGEVTTNGEA
APENGEDGEHGLLTYICDAMELGPQRVLKEESGAKKKKKDEESKQGLRKPELEKAARSRL
SSENCIPNSDEPDSCGTQGPAGVEQVQTQPRGRAARGPGSSGTDSTRKPTSAVGTPDKAQ
KAPAPALAPGPSPGPGQEMYFSLKDMYLENTRAVRLPGEDGPQTLSVQAPGESLKGKAPI
GARDEGVPGAPGQPTHSFTPQPTRPFNRKRFAPPKPKGEATTDSKPISSLSQAPECGAQS
LGKAPPQASVQVPTPPARRRHGIRDSPLQGQAGHRTPGEVLECQTTMAPTVSASSSSDVA
SIGCSTSGSQGIFEPMDMETQEDGRTSANQRPGSKKNVQADGKIQVDGRTRGDGTQIAQR
TWADRKTQVYAGTQESKRPQSDRSAQKGMVTQGRAETQLETAQAGEKVQEDRKAQADEGT
QEDRRMQEETGMQSAGSAPTATEGQSKQEAVTSLGPPSRTPELPPTEGPRAPPSIECFTQ
IPEGSCIPEKPGFLPRSEEAAVTASRNHEQTVLGPLSGNLMLPAQPPHEGSVEQVGGERC
QGPQSSGPVEAKQEDSPFQCPEEEQPGGVPCVDQGGCPPAGLSQEVPTMPSLPGTGLTAS
PKEGLSSTLTSQHRSTAAFLPSEDQALMSSAPTLHLGPGTPTQSHPPETMATSNEGACAQ
VSDVEGRTPGPRSCDPGLIDSLKNYLLLLLKLSSTETSGAGGESQVGAATGGLAPSATLT
PTVEVAGLSPRTSRRILERVENNHLVQSAQTLLLSPCTSRRLTGLLDREVQAGRQALAAA
RGSWGPGPSSLTVPAIVVDEEGPGLASEGASEGEGEVSLEGPGLLGASQESSTGDRLGEA
GGQAVPGQGPSTESIAQEPSQEEKFPGEALTGLPAATPEELALGARRKRFLPKVRAAGDG
EATTPEERESPTVSPRGPRKSLVPGSPGTPGRERRSPTQGRKATMLEVPRVEEELAAGDL
SPSPKAGGLNTELALDEGKQETLAKPRKAKDLLKAPQVIRKIRVEQFPDASGSLKLWCQF
FNILSDSVLTWAKDQCPVGEVGRSAGDEGPAALAIVQASPVDCGVYRCTIHNEHGSASTD
FCLSPEVLSGFISREEGEVGEEIEMTPMVFAKGLADSGCWGDKLFGRLVSEELRGGGYGC
VLRKASQAKVIYGLEPIFESGRTCIIKVSSLLVFGPSSETSLVGRNYDVTIQGCKIQNMS
REYCKIFAAEARAAPGFGEVPEIIPLYLIYRPANNIPYATLEEDLGKPLESYCSREWGSA
GAVTASSSSEAMQKCQTFQHWLYQWTNGSFLVTDLAGVDWKMTDVQIATKLRGYQGLKES
CFPALLDRFASSHQCNAYCELLGLTPLKGPEVAHPQAKAKGSKSPSAGRKGSQLSPQPQK
KGLPSPQGTRKSAASSKAAPQASEPVAAQLLGQPPTQEEGSKAQGMR
Download sequence
Identical sequences 9544.ENSMMUP00000013679 ENSMMUP00000013679 ENSMMUP00000013679

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]