SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013734 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013734
Domain Number 1 Region: 4863-5078
Classification Level Classification E-value
Superfamily GFP-like 4.5e-63
Family Domain G2 of nidogen-1 0.00082
Further Details:      
 
Domain Number 2 Region: 2467-2566
Classification Level Classification E-value
Superfamily Immunoglobulin 1.57e-25
Family I set domains 0.014
Further Details:      
 
Domain Number 3 Region: 3620-3712
Classification Level Classification E-value
Superfamily Immunoglobulin 8.61e-25
Family I set domains 0.0076
Further Details:      
 
Domain Number 4 Region: 3044-3146
Classification Level Classification E-value
Superfamily Immunoglobulin 4.25e-24
Family I set domains 0.0085
Further Details:      
 
Domain Number 5 Region: 3235-3335
Classification Level Classification E-value
Superfamily Immunoglobulin 4.49e-24
Family I set domains 0.0046
Further Details:      
 
Domain Number 6 Region: 1162-1259
Classification Level Classification E-value
Superfamily Immunoglobulin 1.02e-23
Family I set domains 0.0091
Further Details:      
 
Domain Number 7 Region: 2386-2474
Classification Level Classification E-value
Superfamily Immunoglobulin 1.11e-23
Family I set domains 0.019
Further Details:      
 
Domain Number 8 Region: 2575-2662
Classification Level Classification E-value
Superfamily Immunoglobulin 1.16e-23
Family I set domains 0.0086
Further Details:      
 
Domain Number 9 Region: 4067-4164
Classification Level Classification E-value
Superfamily Immunoglobulin 3.12e-23
Family I set domains 0.015
Further Details:      
 
Domain Number 10 Region: 2953-3051
Classification Level Classification E-value
Superfamily Immunoglobulin 7.67e-23
Family I set domains 0.0044
Further Details:      
 
Domain Number 11 Region: 3701-3799
Classification Level Classification E-value
Superfamily Immunoglobulin 9.09e-23
Family I set domains 0.016
Further Details:      
 
Domain Number 12 Region: 1814-1892,1935-2001
Classification Level Classification E-value
Superfamily Immunoglobulin 9.65e-23
Family I set domains 0.014
Further Details:      
 
Domain Number 13 Region: 603-697
Classification Level Classification E-value
Superfamily Immunoglobulin 1.17e-22
Family I set domains 0.02
Further Details:      
 
Domain Number 14 Region: 3979-4075
Classification Level Classification E-value
Superfamily Immunoglobulin 1.42e-22
Family I set domains 0.026
Further Details:      
 
Domain Number 15 Region: 2292-2380
Classification Level Classification E-value
Superfamily Immunoglobulin 2.22e-22
Family I set domains 0.011
Further Details:      
 
Domain Number 16 Region: 3895-3987
Classification Level Classification E-value
Superfamily Immunoglobulin 3.52e-22
Family I set domains 0.018
Further Details:      
 
Domain Number 17 Region: 4338-4435
Classification Level Classification E-value
Superfamily Immunoglobulin 3.77e-22
Family I set domains 0.0079
Further Details:      
 
Domain Number 18 Region: 2670-2761
Classification Level Classification E-value
Superfamily Immunoglobulin 5.99e-22
Family I set domains 0.015
Further Details:      
 
Domain Number 19 Region: 2782-2864
Classification Level Classification E-value
Superfamily Immunoglobulin 6.91e-22
Family I set domains 0.022
Further Details:      
 
Domain Number 20 Region: 2872-2960
Classification Level Classification E-value
Superfamily Immunoglobulin 1.12e-21
Family I set domains 0.0061
Further Details:      
 
Domain Number 21 Region: 1740-1823
Classification Level Classification E-value
Superfamily Immunoglobulin 1.29e-21
Family I set domains 0.02
Further Details:      
 
Domain Number 22 Region: 784-883
Classification Level Classification E-value
Superfamily Immunoglobulin 1.56e-21
Family I set domains 0.018
Further Details:      
 
Domain Number 23 Region: 1084-1175
Classification Level Classification E-value
Superfamily Immunoglobulin 1.96e-21
Family I set domains 0.011
Further Details:      
 
Domain Number 24 Region: 1442-1543
Classification Level Classification E-value
Superfamily Immunoglobulin 2.12e-21
Family I set domains 0.029
Further Details:      
 
Domain Number 25 Region: 4157-4255
Classification Level Classification E-value
Superfamily Immunoglobulin 2.29e-21
Family I set domains 0.019
Further Details:      
 
Domain Number 26 Region: 2095-2190
Classification Level Classification E-value
Superfamily Immunoglobulin 2.52e-21
Family I set domains 0.007
Further Details:      
 
Domain Number 27 Region: 3139-3239
Classification Level Classification E-value
Superfamily Immunoglobulin 2.7e-21
Family I set domains 0.011
Further Details:      
 
Domain Number 28 Region: 42-217
Classification Level Classification E-value
Superfamily vWA-like 2.72e-21
Family Integrin A (or I) domain 0.025
Further Details:      
 
Domain Number 29 Region: 887-981
Classification Level Classification E-value
Superfamily Immunoglobulin 3.8e-21
Family I set domains 0.0086
Further Details:      
 
Domain Number 30 Region: 3793-3892
Classification Level Classification E-value
Superfamily Immunoglobulin 6.03e-21
Family I set domains 0.0058
Further Details:      
 
Domain Number 31 Region: 4243-4341
Classification Level Classification E-value
Superfamily Immunoglobulin 8.36e-21
Family I set domains 0.017
Further Details:      
 
Domain Number 32 Region: 1537-1636
Classification Level Classification E-value
Superfamily Immunoglobulin 1.11e-20
Family I set domains 0.0046
Further Details:      
 
Domain Number 33 Region: 2001-2100
Classification Level Classification E-value
Superfamily Immunoglobulin 1.3e-20
Family I set domains 0.014
Further Details:      
 
Domain Number 34 Region: 518-618
Classification Level Classification E-value
Superfamily Immunoglobulin 2.38e-20
Family I set domains 0.056
Further Details:      
 
Domain Number 35 Region: 3433-3489,3543-3609
Classification Level Classification E-value
Superfamily Immunoglobulin 3.01e-20
Family I set domains 0.031
Further Details:      
 
Domain Number 36 Region: 4426-4520
Classification Level Classification E-value
Superfamily Immunoglobulin 6.39e-20
Family I set domains 0.01
Further Details:      
 
Domain Number 37 Region: 1629-1730
Classification Level Classification E-value
Superfamily Immunoglobulin 2.09e-19
Family I set domains 0.005
Further Details:      
 
Domain Number 38 Region: 3345-3428
Classification Level Classification E-value
Superfamily Immunoglobulin 2.41e-19
Family I set domains 0.011
Further Details:      
 
Domain Number 39 Region: 2184-2285
Classification Level Classification E-value
Superfamily Immunoglobulin 1.5e-18
Family I set domains 0.0084
Further Details:      
 
Domain Number 40 Region: 5084-5223
Classification Level Classification E-value
Superfamily Growth factor receptor domain 2.35e-17
Family Growth factor receptor domain 0.02
Further Details:      
 
Domain Number 41 Region: 979-1072
Classification Level Classification E-value
Superfamily Immunoglobulin 2.74e-17
Family I set domains 0.0082
Further Details:      
 
Domain Number 42 Region: 702-797
Classification Level Classification E-value
Superfamily Immunoglobulin 3.23e-17
Family I set domains 0.014
Further Details:      
 
Domain Number 43 Region: 1360-1450
Classification Level Classification E-value
Superfamily Immunoglobulin 3.55e-17
Family I set domains 0.032
Further Details:      
 
Domain Number 44 Region: 4575-4633
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 5.89e-16
Family TSP-1 type 1 repeat 0.00028
Further Details:      
 
Domain Number 45 Region: 4632-4690
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000051
Family TSP-1 type 1 repeat 0.00019
Further Details:      
 
Domain Number 46 Region: 4520-4576
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.00000000000000902
Family TSP-1 type 1 repeat 0.00029
Further Details:      
 
Domain Number 47 Region: 4690-4747
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000314
Family TSP-1 type 1 repeat 0.00023
Further Details:      
 
Domain Number 48 Region: 4804-4861
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.0000000000000405
Family TSP-1 type 1 repeat 0.00024
Further Details:      
 
Domain Number 49 Region: 4746-4804
Classification Level Classification E-value
Superfamily TSP-1 type 1 repeat 0.000000000000235
Family TSP-1 type 1 repeat 0.00033
Further Details:      
 
Domain Number 50 Region: 5280-5403
Classification Level Classification E-value
Superfamily Growth factor receptor domain 0.00000000000033
Family Growth factor receptor domain 0.012
Further Details:      
 
Domain Number 51 Region: 445-524
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000159
Family I set domains 0.039
Further Details:      
 
Domain Number 52 Region: 5218-5260
Classification Level Classification E-value
Superfamily EGF/Laminin 0.000031
Family EGF-type module 0.023
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013734   Gene: ENSMMUG00000010474   Transcript: ENSMMUT00000014661
Sequence length 5511
Comment pep:known_by_projection chromosome:MMUL_1:1:184523063:184977116:-1 gene:ENSMMUG00000010474 transcript:ENSMMUT00000014661 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MISREVVHTVFLFALLYSSLAQDASPQSEIRAEEIPEGASTLAFVFDVTGSMYDDLVQVI
EGASKILETSLKRPKRPLFNFALVPFHDPEIGPVTITTDPKKFQYELRELYVQGGGDCPE
MSIGAIKIALEISLPGSFIYVFTDARSKDYRLTHEVLQLIQQKQSQVVFVLTGDCDDRTH
IGYKVYEEIASTSSGQVFHLDKKQVNEVLKWVEEAVQASKVHLLSTDHLEQAVNTWRIPF
DPSLKEVTVSLSGPSPVIEIRNPLGKLIKKGFGLNELLNIHNSAKVVNVKEPEAGMWTVK
TSSSGRHSVRITGLSTIDFRAGFSRKPTLDFKKTVSRPVQGIPTYVLLNTSGISTPARID
LLELLSISGSSLKTIPVKYYPDRKPYGIWNISDFVPPNEAFFLKVTGYDEDDYLFQRVSS
VSFSSIVPDAPKVTMPEKTPGYYLQPGQIPCSVDSLLPFTLSFVRNGVTLGVDQYLKESA
SVNLDIEKVTLSDEGFYECIAVSSAGTGRAQTFFDVSEPPPVIQVPSNVTVTPGETAVLT
CLIISAVDYNLTWQRNDRDVRLAEPARIRTLTNLSLELKSVKFNDAGEYLCMVSSEGGSS
AASVFLTVQEPPKVTVMPKNQSFTGGSEVSIMCSATGYPKPKIAWTVNDMFIVGSHRYRM
TSDGTLFIKNAGPKDAGIYGCLASNSAGTDKQSSTLRYIPKLIVVQSELLVALGDITIME
CKTSGIPPPQVKWFKGDLELRPSTFLVIDPLLGLLKIQETQDLDAGDYTCVAINEAGRAT
GKITLDVGSPPVFIQEPADVSMEIGSNVTLPCYVQGYPEPTIKWRRLDNMPIFSRPFSVS
SISQLRTGALFILNLWASDKGTYICEAENQFGKIQSETTITVTGLVAPLIGISPSVANVI
EGQQLTLPCTLLAGNPIPERRWIKNSAMLLQNPYITVRSDGSLHIERVQLQDGGEYTCVA
SNVAGTNNKTTSVVVHVLPTIQHGQQILSTIEGIPVTLPCKASGIPKPSVIWSKKGELIS
TSSAKFSAGADGSLYVVSPGGEESGEYVCTATNAAGYAKRKVQLTVYVRPRVFGDQRGLS
QDKPVEISVLAGEEVTLPCEVKSLPPPIITWAKETQLISPFSPRHTFLPSGSMKITETRI
TDSGMYLCVATNIAGNVTQAVKLNVHVPPKIQRGPKHLKVQVGQRVDIPCNAQGTPLPVI
TWSKGGSTMLVDGVQHVSNPDGTLSIDQAMPSDAGIYTCVATNIAGTDETEITLHVQEPP
TVEDLEPPYNTPFQERVANQRIAFPCPAKGMRWHNVILFQNAILNPNCHPYKIPHQSLVQ
HLSIIETNPSFGNSLNKYFFSFSYDSSLFAVPPVIKDKEQVTNVSVLLNQLTNLFCEVEG
TPSPIIMWYKDNVQVTESSTVQIVNNGKILKFFKATPEDAGRYSCKXXXXXXXTSQKYFN
IDVLVPPTIIGTNFPNEVSVVLSHDVALECQVKGTPFPDIHWFKDGKPLFLGDPNVELLD
RGQVLHLKNARRSDKGRYQCTVSNAAGKQAKDIKLTIYIPPSIKGGNVTSDISVLINSII
KLECETRGLPMPAITWYKDGQPIMSSSQALYIDKGQYLHIPRAQVSDSAIYMCHVVNVAG
TAEKSFHVDVYVPPMIEGDLAMPLNKQVVIAHSLTLECKAAGNPSPILTWLKDGVPVKAN
DNIHIEAGGKKLEIMSAQEIDQGQYICVATSVAGEKEIKYEVDVLVPPAIEGGDETSYFI
VMVNNLLELDCHVTGSPPPTIMWLKDGQLIDERDGFKILLNGRKLVIAQAQVSDTGLYRC
MATNTAGDHKKEFEVTVHVPPTIKSSGLSERVVVKYKPVTLQCIANGIPNPSITWLKDDQ
PVNTAQGNLKVSVSITQPKLGKLHRSSWKYQIILSLKYSTYKYLFGPLAEPPSLEDAGKM
LNETVVVSNPVQLECKAAGNPVPVITWYKDNRLLSGSTSMTFLNRGQIIDIESAQISDAG
IYKCVAINSAGATELFYSLQVHVAPSISGSNNMVAVVVNNPVRLECEARGIPAPSLTWLK
DGSPVSSFSNGIQVLSGGRILALTSAQISDTGRYTCVAVNAAGEKQRDIDLRVYVPPNIM
GEEQNVSVLISQAVELLCQSDAIPPPTLTWLKDGHPLLKKPGLSISENGSVLKIEDAQVQ
DTGRYTCEATNVAGKTEKNYNVNIWVPPNIGGSDELTQLTVIEGNLISLLCESSGIPPPN
LIWKKKGSPVLTDSMGRVRILSGGRQLQISIAEKSDAALYSCVASNVAGTAKKEYSLQVY
IRPTITNSGSHPTEIIVTLGKSISLECEVQGIPPPTVSWMKDGRPLIKAKGVEILDEGHI
LQLKNIHVSDTGRYVCVAVNVAGMTDKKYDLSVHAPPSIIGNHRSPENISVVEKNSVSLT
CEASGIPLPSITWLKDGWPVSLSNSVRILSGGRMLRLMQTRMEDAGQYTCVVRNAAGEER
KIFGLSVLVPPHILGENTLEDVKVKEKQSVTLTCEVTGNPVPEITWHKDGQLLQEDEAHH
IMSGGRFLQITNAQVSHTGRYTCLASSPAGDKSRSFSLNVFVSPTIAGVGSDGSPEDVTV
ILNSPTSLVCEAYSYPPATITWFKDGTPLESNRNIRILPGGRTLQILNAQKDNAGRYSCV
ATNEAGEMIKHYEVKVYIPPIINKGDLWGPGLSPKEVKIKVNNTLTLECEAYAIPSASLS
WYKDGPPLKSDDHVNIAANGHTLQIKEAQISDTGRYTCVASNIAGEDELDFDVNIQVPPS
FQKLWEIGNMLDTGRSGEAKDVIINNPISLYCETNAAPPPTLTWYKDGHPLTSSDKVLIL
PGGRVLQIPRAKVEDAGRYTCVAVNEAGEDSLQYDVRVLVPPIIKGANSDLPAEVTVLVN
KSALMECLSSGSPAPRNSWQKDGQPLLEDDHHKFLSNGRILQILNTQIIDIGRYVCVAEN
TAGSAKKYFNLNVNVPPSVIGPKSENLTVVVNNFISLTCEVSGFPPPDLSWLKNEQPIKL
NTNALIVPGGRTLQIIRAKVSDGGEYTCIAINQAGESKKKFSLTVYVPPSIKDHDSESLS
VVNVREGTSVSLECESNAVPPPVITWYKNGRMITESTHVEILADGQMLHIKKAEVSDTGQ
YVCRAINVAGRDDKNFHLNVYVPPSIEGPEKEVIVETISNPVMLTCDATGIPPPTIAWLK
NHKHIENSDSLEVHILSGGSKLQIARSQRSDSGNYTCIASNMEGRAQKYYFLSIQVPPSV
AGAEIPSDVSVLLGENVELVCNANGIPTPVIQWLKDGKPVASGETERIRVSANGSTLNIY
GALTSDTGKYTCVATNPAGEEDRIFNLNVFVTPTIRGNKDEAEKLMTLVDTSINIECRAT
GTPPPQINWLKNGLPLPLSSHIRLLAAGQVIRIVRAQVSDAAVYTCVAANRAGVDNKHYS
LQVFAPPNMDNSMGTEEITILKGSSTSMACITHGTPAPSMAWLRDSQPLGLDAHLTELFH
FPCSNQFLCECEFVLDFQVFLTRNIEIEGLLLFFIPIEPPHINGSEEHEEISVIVNNPLE
LACIASGIPAPKMTWMKDGRPLPQTDQLQTLEGGEVLRISTAQVEDTGRYTCLASSPAGD
DDKEYLVRVHVPPNIAGTDEPQDVTVLRNRQVTLECKSDAVPPPVITWLKNGERLQATPR
VRILSGGRYLQINNADLGDTANYTCVASNIAGKTTREFILTVNVPPNIKRGPQSLVILLN
KSAVLECIAEGVPTPRITWRKDGAVLAGNHARYSILENGFLHIQSAHVTDTGRYLCMATN
AAGTDRRRIDLQVHVPPSIAPGPTNMTVTVNVQTTLACEATGIPKPSINWRKNGHLLNVD
QNQNSYRLLSSGSLVIISPSVDDTATYECTVANGAGDDKRTVDLTVQVPPSIADEPTDFL
VTKHAPAVITCTASGVPFPSIHWTKNGIRLLPRGDGYRILSSGAIEILATQLNHAGRYTC
VARNAAGSAHRHVTLHVHEPPVIQPQPSELQVILNNPILLPCEATGTPSPFITWQKEGIN
VITSGKNHAVLPSGSLQIFRAVREDAGTYMCVAQNPAGTALGKVKLNVQVPPVISPHLKE
YVIAVDKPITLPCKADGVPPPDITWHKDGRTIVESIRQRVLSSGSLQIAFAQSGDAGHYT
CMAANVAGSSSTSTKLTVHVPPRIRSTEGHYTVNENSQAILPCVADGIPTPAINWKKDNV
LLANLLGKYTAEPYGELILENVVLEDSGFYTCVANNAAGEDTHTVSLTVHVLPTFTELPG
DVSLNKGEQLRLSCKATGIPLPKLTWTFNNNIIPAHFDSVNGHSELVIERVSKEDSGTYV
CTAENSVGFVKAIGFVYVKEPPVFKGDYPSNWIEPLGGNAILNCEVKGDPTPTIQWNRKG
VDIEISHRIRKLGNGSLAIYGTVNEDAGDYTCVATNEAGVVERSMSLTLQSPPIITLEPV
ETVINAGGKVILNCQATGEPQPTITWSRQGHSISWDDRVNMLSNNSLYIADAQKDDTSEF
ECVARNLMGSVLVRVPVIVQVHGGFSQWSAWRACSVTCGKGIQKRSRLCNQPLPANGGKP
CQGSDLETRNCQNKPCPVDGSWSEWSPWEECTRSCGHGNRTRTRTCNNPSAQHGGRPCEG
NAVEIIMCNIRPCPVHGAWSTWQPWGTCSGSCGKGAQTRARLCNNPPPALGGSYCDGAET
QMQVCNERHCPIDGKWATWASWSACSVSCGGGARQRTRDCSDPVPQYGGRKCEGSDVQSD
FCNSDPCPTHGNWSPWSGWGTCSRTCNGGQMRRYRTCDNPRPSNGGRTCGGPDSQIQRCN
TDMCPVDGSWGSWHSWSQCSASCGGGEKTRKRLCDHPVPAKGGRPCSGDTTQVTRCNVQA
CPGGPQRARGSVIGNINDVEFGIAFLNATITDSPNSDTRIIRAKITNVPRSLGSAMRKIV
SILNPIYWATAKEIGEAVNGFTLTNAVFKRETQVEFATGEILRMTHIARGLDSDGALLLD
IVVSGYVLQLQSPAEVTVKDYTEDYIQTGPGQLYAYSTRLFTIDGISIPYTWNHTVFYDQ
ARGRMPFLVETLHASSVESDYNQLEETLSFKIHASISKGDRSNQCPSGFTLDSVGPFCAD
EDECAAGNPCSHTCHNAMGTYYCSCPKGLTIAADGRTCQDIDECALGRHTCHAGQDCDNT
IGSYRCVVHCGTGFRRTSDGLSCQDINECQESSPCHQRCFNAIGSFHCGCEPGYQLKGRK
CMDVNECRQNVCRPDQHCKNTRGGYKCIDLCPNGMTKAENGTCIDIDECKDGTHQCRYNQ
ICENTRGSYRCVCPRGYRSQGVGRPCMDIDECENTDACQHECKNTFGSYQCICPPGYQLT
LNGKTCQDIDECLEQNVHCGPNRMCFNMRGSYQCIDTPCPPNYQRDPVSGFCLKNCPPND
LECALSPYALEYKLVSLPFGIATNQDLIRLVAYTQDGVMHPRTTFLMIDEEQTVPFALRD
ENLKGVVYTTRPLREAETYRMRVRASSYSANGTIEYQTTFIVYIAVSAYPY
Download sequence
Identical sequences ENSMMUP00000013734

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]