SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013779 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013779
Domain Number 1 Region: 6-222
Classification Level Classification E-value
Superfamily Ribulose-phoshate binding barrel 5.21e-131
Family SCOPe 0.000000931
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013779   Gene: ENSMMUG00000010513   Transcript: ENSMMUT00000014709
Sequence length 228
Comment pep:known chromosome:MMUL_1:12:73783929:73802588:1 gene:ENSMMUG00000010513 transcript:ENSMMUT00000014709 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MASGCKIGPSILNSDLANLGAECLRMLDSGADYLHLDVMDGHFVPNITFGHPVVESLRKQ
LGQDPFFDMHMMVSKPEQWVKPMAVAGANQYTFHLEATENPGALIKDIRENGMKVGLAIK
PGTSVEYLAPWANQIDMALVMTVEPGFGGQKFMEDMMPKVHWLRTQFPSLDIEVDGGVGP
DTVHKCAEAGANMIVSGSAIMRSEDPRSVINLLRNVCSEAAQKRSLDR
Download sequence
Identical sequences A0A0D9RC37 A0A2K5NYJ1 A0A2K5TU71 A0A2K6DFV5 A0A2K6JPR3 A0A2K6PD48 H2P8G8 H9YUF6 K7A873 Q96AT9
ENSPPYP00000014676 ENSMMUP00000013779 ENSMMUP00000013778 gi|40385883|ref|NP_954699.1| 3ovp_A 3ovp_B 3ovq_A 3ovq_B 3ovr_A 3ovr_B 400234 GO.38936 ENSPANP00000015004 ENSP00000352401 ENSPPYP00000014676 ENSNLEP00000008745 ENSP00000346501 ENSNLEP00000008746 NP_001248643.1.72884 NP_954699.1.87134 NP_954699.1.92137 XP_001146078.1.37143 XP_003254067.1.23891 XP_003807021.1.60992 XP_005574213.1.63531 XP_007964314.1.81039 XP_010353231.1.97406 XP_011738758.1.29376 XP_011787720.1.43180 XP_011821922.1.47321 XP_011903198.1.92194 XP_017744852.1.44346 ENSP00000352401 cath|current|3ovpA00/4-224 cath|current|3ovpB00/4-225 cath|current|3ovqA00/4-222 cath|current|3ovqB00/5-223 cath|current|3ovrA00/4-224 cath|current|3ovrB00/4-223 9544.ENSMMUP00000013779 9598.ENSPTRP00000022012 9600.ENSPPYP00000014676 9606.ENSP00000352401

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]