SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013878 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013878
Domain Number 1 Region: 41-86
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000000000209
Family EGF-type module 0.00015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013878   Gene: ENSMMUG00000010591   Transcript: ENSMMUT00000014813
Sequence length 162
Comment pep:known_by_projection chromosome:MMUL_1:13:70766073:70871847:-1 gene:ENSMMUG00000010591 transcript:ENSMMUT00000014813 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MVPSAGQLALFALGIVLAACQALENSTSLLSDPPVAAAVVSHFNDCPDSHTQFCFHGTCR
FLVQEDKPACVCHSGYVGARCEHADLLAVVAASQKKQAITALVVVSIVALAVLIITCVLI
HCCQVRKHCEWCRALICRHEKPSALLKGRTACCHSETGCRFY
Download sequence
Identical sequences G7PMF3
ENSMMUP00000013878 XP_011800617.1.43180 ENSMMUP00000013878 9544.ENSMMUP00000013878

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]