SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013894 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013894
Domain Number 1 Region: 109-221
Classification Level Classification E-value
Superfamily C-type lectin-like 1.75e-29
Family C-type lectin domain 0.000000941
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013894   Gene: ENSMMUG00000010600   Transcript: ENSMMUT00000014829
Sequence length 222
Comment pep:known_by_projection chromosome:MMUL_1:14:16028656:16175145:1 gene:ENSMMUG00000010600 transcript:ENSMMUT00000014829 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MKLLLLLALLFGAVSALHLRPETSTFDSTLGAKTLPEDEEMPEQEVEEILSRELEEEEEG
GSGSEDASKEDGAVKLISVPDMVDKNLTCPEEEDTVKVVGIPGCPTCRYLLVRSPHTFNQ
AWFTCQRCYRGNLASIHNFNTNSQIQWSVRALNQGQVWIGGRITGSGRCRRFQWVDGSRW
NFAYWAAHQPWSRGGHCVSLCTRGGHWRRAHCLRRLPFICSY
Download sequence
Identical sequences F7CG87
XP_002799599.1.72884 XP_014969648.1.72884 XP_014969649.1.72884 XP_014969650.1.72884 9544.ENSMMUP00000037210 ENSMMUP00000013894 ENSMMUP00000013894 ENSMMUP00000037210

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]