SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000013952 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000013952
Domain Number 1 Region: 20-136
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000000204
Family V set domains (antibody variable domain-like) 0.013
Further Details:      
 
Domain Number 2 Region: 145-228
Classification Level Classification E-value
Superfamily Immunoglobulin 0.00000000878
Family C1 set domains (antibody constant domain-like) 0.084
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000013952   Gene: ENSMMUG00000010647   Transcript: ENSMMUT00000014893
Sequence length 302
Comment pep:novel chromosome:MMUL_1:3:2473675:2481915:1 gene:ENSMMUG00000010647 transcript:ENSMMUT00000014893 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VVFSSPGLLLLLFSSLRADTQEKEVRAMVGSDVELSCACPEGSRFDLNDVYVYWQTSESK
TVVTYHIPQNSSLDNVDSHYRNRALMSPAGMQRGDFSLRLFNVTPQDEQKFHCLVLSQSL
GFQEVLSVVVTLHVAANFSVPVVSTPHNPSQDKLTFTCTSINGYPRPNVYWINKTDNSLL
DQALQNDTVFLNTRGLYDVVSVLRIARTPSLNIGCCIENVLLRQNLTVGSQTGNNIGERD
KITENPVSTREKTEVTWSVLAVLCLLVAVAVAIGWVCRDRWLRRSYAGVWAVRPEPELAG
EF
Download sequence
Identical sequences 9544.ENSMMUP00000013952 ENSMMUP00000013952 ENSMMUP00000013952

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]