SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014096 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014096
Domain Number 1 Region: 6-116
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 0.0000000000489
Family Deoxycytidylate deaminase-like 0.019
Further Details:      
 
Domain Number 2 Region: 191-279
Classification Level Classification E-value
Superfamily Cytidine deaminase-like 0.0000564
Family Deoxycytidylate deaminase-like 0.068
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014096   Gene: ENSMMUG00000004015   Transcript: ENSMMUT00000015044
Sequence length 282
Comment pep:known_by_projection chromosome:MMUL_1:10:82885299:82891479:1 gene:ENSMMUG00000004015 transcript:ENSMMUT00000015044 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QVYSKPEHHAEMCFLSRFCGNQLPAYKRFQITWFVSWNPCPDCVAKVIEFLAEHPNVTLT
ISTARLYYYWGRDWQRALCRLRQAGARVKIMDYEEFAYCWENFVYNEDQSFMPWYKFNDN
YAFLHRMLKEILRHLMDPDTFTSNFNNDVSVRGRHQTYLCYEVERLDNGTWVPMDQHWGF
LCNQAKNVLRGDYGCHAELCFLGWVPSWQLDPAQTYRVTWFISWSPCFSWGCAEQVRAFL
QENTHVRLHIFAARIYDYDPLYQEALRTLRDAGAQVSIMTYD
Download sequence
Identical sequences ENSMMUP00000014096

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]