SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSMMUP00000014107 from Macaca mulatta 76_1

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSMMUP00000014107
Domain Number 1 Region: 21-170
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.06e-25
Family Phosphate binding protein-like 0.000000347
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSMMUP00000014107   Gene: ENSMMUG00000001661   Transcript: ENSMMUT00000015055
Sequence length 200
Comment pep:known_by_projection chromosome:MMUL_1:15:1080991:1138887:-1 gene:ENSMMUG00000001661 transcript:ENSMMUT00000015055 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
SFSARILGMVWAGFAMIIVASYTANLAAFLVLDRPEERITGINDPRLRNPSDKFIYATVK
QSSVDIYFRRQVELSTMYRHMEKHNYESAAEAIQAVRDNKLHAFIWDSDVLEFEASQKCD
LVTTGELFFRSGFGIGMRKDSPWKQNVSLSILKSHENGFMEDLDKTWVRYQECDSRSNAP
ATLTFENMAGVFMLVAGGIV
Download sequence
Identical sequences ENSMMUP00000014107

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]